KEGG   Collimonas fungivorans: CFU_1411Help
Entry
CFU_1411          CDS       T01583                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cfu  Collimonas fungivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CFU_1411 (hemD)
Enzymes [BR:cfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CFU_1411 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1663267..1664082
Genome map
AA seq 271 aa AA seqDB search
MQGGLVPLAPPAGNSALRPVIITRPLQQASALARQIAARGRQPVVFPLLEILPLNDNAPL
QAVLGELADFALVVFVSPNAIDAAFRHIAGWPRQLPIGIVGEGSRAALARHGLTAHNTTI
FSPPDPARTDSEGLLQALDLDSLRGRQVLLVRGESGREFFADSLLAAGIKVQAVAAYRRQ
APVLDASLRTRLQFLLDTENDWILTSSEALRHLVDLVQALAGGAGVAKIQQQKLLVPHAR
IAETAHTLGFTDVTLTGSGDERLLDALQFPL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaggaggcctagtgccactagcgccgccagcgggcaactctgccttgcgcccggtc
atcatcaccaggccgctgcagcaagcctcggcgctggcgcggcagatcgcggcgcgcggc
cgccagccggtggttttccccttgctggaaatcctgccgctaaacgataacgcgccgttg
caagccgtcctcggcgagctcgccgactttgcgctagtggtgtttgtcagcccgaacgcc
atcgatgccgcatttcgccatatcgccggctggcctcggcagttgccgatcggtatcgtc
ggcgagggcagcagggcggcgctggcgcgccacggcctgacggcgcacaacaccaccatc
ttcagcccgcccgatccggccaggaccgattccgaaggtttgctgcaggcgctcgacctt
gattccttgcgcggccgccaggtattgctggtgcgcggcgaaagcggccgcgaatttttt
gccgacagcttgctggcggcgggtatcaaggtgcaggccgtagctgcttaccgacgccag
gcgccggtgctcgatgcctccttgagaacccgcctgcaattcctgctggataccgaaaac
gactggatattgaccagctcggaagcgctcaggcacctggtcgacctggtgcaagcgctt
gcgggcggcgccggtgttgcaaaaatccaacagcagaaactccttgtcccgcatgcccgt
attgccgaaacggcacatacgcttggatttactgacgttactctgaccggctcaggcgac
gaacggctactcgacgcgttacaattcccgctatga

  All links  
No link information was found.   
DBGET integrated database retrieval system