KEGG   Collimonas fungivorans: CFU_1412Help
Entry
CFU_1412          CDS       T01583                                 

Gene name
hemX
Definition
hypothetical protein
Orthology
K02496  
uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
cfu  Collimonas fungivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CFU_1412 (hemX)
Enzymes [BR:cfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CFU_1412 (hemX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1664079..1665260
Genome map
AA seq 393 aa AA seqDB search
MNESIPTPESNQPAGPAVSATASPPSQPVLQPYKFTQDKSPKRSLGLVYGILLLLALLLA
AQWWVMHNENGKLRQELARRLQAGDSINTETKVLVKSVQDESKELQGKVSVLENKQVESQ
SQQLALEQLYKDLSRNSDDWTLAQVEDVLSTASQQLQLAGNVQGALIALQNADKNLSRSD
KPQFIIVRRAIASDIEKLKALPTLDVTGIAVRLDSIIGQIDGMPLLSDEKPIVGISKPNN
QAVVGGPKAAGSGNIAKTQVAADAVVTDWKNSLKDKWQSWSSEMWTEISQLIRVRTVDTP
DALLLSPTQAYYARENLKLRLLNARLGLLSRNESAFRSDLIAAQETITKYFDTRAKQTQT
VQTLLKQVQSSNLSITMPALDSPAAIRTYKGKP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaatcgatacccaccccagaatcgaaccagcctgctggtcctgccgtcagcgcc
acggcatcgccaccgtcgcagccggtgctgcagccttacaagttcacccaggacaagagt
ccgaagcgctcgcttggcctggtgtacggcatattgctgctgctggccctgctgctggcg
gcgcaatggtgggtgatgcacaacgagaacggcaagctgcgccaggaactggcgcgccgc
ctgcaggcgggcgacagcatcaatacggaaaccaaggtgctggtgaagtcggtgcaggac
gagtcgaaggaactgcaaggcaaggtcagcgtgctggaaaacaagcaggtcgaatcgcaa
agccagcaactggcgctggagcagctgtataaagacctgtcgcgcaacagcgatgactgg
accctggcccaggtggaagacgtgctgtcgaccgccagccagcaattgcaactggccggc
aacgtccagggcgcactgatcgcactgcagaacgccgacaagaacctgtcgcgctccgac
aagccgcaattcatcatcgtgcggcgcgccatcgccagcgacatcgaaaaactgaaggcc
ttgccgacgctggacgtcaccggcatcgccgtgcgtctcgacagcatcatcggccagatc
gacggcatgcccttgctgtccgatgaaaaaccgatcgtcggcatcagcaagccgaataac
caggccgtggtcggtgggcctaaggccgccggttccggcaatatcgccaaaacccaggtg
gcggcggatgccgtggtgaccgactggaaaaacagcctgaaggacaagtggcaaagctgg
agcagcgagatgtggaccgaaatcagccagctgatcagggtgcgcaccgtcgataccccc
gacgccttgctgctgtcgccgacccaggcctactatgcccgggagaacctgaagctgcgc
ctgctcaatgcccgcctcggcctgctgtcgcgcaacgaatcagcattccgcagcgacctg
atcgccgcccaggaaaccatcaccaaatatttcgacacgcgggccaagcagacccagacc
gtgcagaccttgctcaagcaggtccaaagcagcaatctttcgatcaccatgccggcgctg
gatagcccggcggcgatccgtacttacaaaggcaagccatag

DBGET integrated database retrieval system