KEGG   Collimonas fungivorans: CFU_1446Help
Entry
CFU_1446          CDS       T01583                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cfu  Collimonas fungivorans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CFU_1446 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFU_1446 (glk)
   00052 Galactose metabolism
    CFU_1446 (glk)
   00500 Starch and sucrose metabolism
    CFU_1446 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CFU_1446 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CFU_1446 (glk)
   00524 Butirosin and neomycin biosynthesis
    CFU_1446 (glk)
Enzymes [BR:cfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CFU_1446 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1710693..1712666
Genome map
AA seq 657 aa AA seqDB search
MSSSTIMSASENPATSYLDGPRLLADVGGTNARFGLERAPGQIDSIQTLRCADYAEFALA
VEAYLSGSEHPQVRHAAIAIANPVQGDDIKMTNHDWEFSIETTRRRLNLDTLLVVNDFTA
LSMSLPHLEQSHCIQVGGGRALSGGVVGLVGAGTGLGVGGLIPTEGRWIALGSEGGHVTF
APSDAREAAVLAYCWRTYSHVSAERLVSGPGIEMIYQALSDMQGVAKPEPLQTAQIVERA
LQGQDGLCMEVVEVFCGMLGTVASDVAVTLGTLGGLYIGGGVVPRLGEYFARSPFRARFE
SKGRFSNYLARIPTFVITAPYPAFVGVAAILSEHLGGGNAVPILEKIRKARDQFSPAEQK
VASLILAHPRAVMSEPISEIARRADVSQPTVIRFCRTMGCQGLADFKLKLASGVTGTVPV
AHSQVHVGDSSLDVGVKVVDNTISAMMEVRDNLNADTLSRVIEVLSQASRIEFYGFGSCG
LVAEDAQQKFFRLGIPSSAYTDPQLQEVSAAMLKSSDVVVVISNSGRLRHLAPAVEVAVH
SGATIIALAPSNSQLAKRAHYTLAVEHDESSMMHIPMVSRILLLLLIDVMAVGVSLNRSS
PFAELQRQAKRGILTHIASLGESDSDKITAEGDGKPAQSKRSDQEVTLSPNVISHIK
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcatccacgatcatgagcgctagcgagaatccggcaactagctatctggatggc
ccgcgtctgctggcggacgtcggcggcaccaatgcgcgcttcgggctggagcgggcgcca
ggccagatcgattcgattcagaccttgcgctgcgccgattacgccgagtttgcgctggcg
gtggaagcctacctgtcgggcagcgaacatccgcaagtgcggcatgcggcgatcgccatc
gccaatccggtgcaaggcgacgatatcaagatgaccaatcacgattgggaattttcgata
gaaaccacgcgccgccgcctgaatctggatacgctgctggtggtcaacgatttcactgcg
ctgtcgatgtccttgccgcacctggagcaatcgcattgcatccaggtcggcggcggcagg
gcgctgagcggcggcgtggtaggcctggtcggcgccggcaccgggctcggcgtcggcggc
ctgattcctaccgagggccgctggatcgcgctgggcagcgagggcggccacgtcacgttt
gcgcccagcgacgcgcgcgaggcggcggtgctggcttactgctggcgtacttattcgcac
gtttcagccgagcgcctggtttccggccccggcatcgaaatgatttaccaggctttatct
gatatgcagggcgtcgccaagcctgagcctttgcagacggcgcagatcgtcgaacgcgcg
ctgcaaggccaggacggcctgtgcatggaagtggtagaagtcttttgcggcatgctggga
acggtggcgagcgatgtcgcggtgaccctgggcacgctgggcggcttgtacatcggcggc
ggcgtggtgccgcgcctgggcgaatatttcgcgcgttcgccgttccgcgcccgcttcgag
agcaaggggcgtttcagcaactacctggcaagaattcctacttttgtgattaccgcgccg
tatccggcgtttgtcggcgtcgccgcgattctttccgagcacctgggcggcggcaacgcc
gtgcctatcctggaaaagatccgcaaggcgcgcgaccagttttcaccggccgagcagaag
gtcgccagcctgatcctggcccacccgcgcgccgtgatgagcgagccgatttcagaaatc
gccaggcgcgccgacgtcagccagccgaccgtgatccgtttctgccgcaccatgggctgc
caggggctggccgatttcaagctgaagctggcttccggcgtcaccggcacggtgccggtc
gcgcacagtcaggtgcatgtcggcgactcctcgctagatgtcggcgtcaaggtggtcgac
aacaccatttccgcgatgatggaagtgcgcgacaacctcaacgccgataccttgtcgcgt
gtgatcgaagtattgagccaggccagccgcatcgagttctacggcttcggcagctgcggc
ctggtggctgaagatgcgcaacagaagttcttccgcctggggattccctcctcggcgtat
accgatccgcagctgcaggaagtttccgccgccatgctgaaaagcagcgacgtggtggtg
gtgatttcgaattcgggacgtttgcgccacctggcgccggcggtcgaggtcgcggtgcat
tccggcgccaccatcattgccctggcgcccagcaattcgcaactggccaagcgcgcgcat
tacacgctggcggtcgagcatgacgagagcagcatgatgcacatcccgatggtgtcgcgg
atcctgctgctgctactgatcgatgtaatggcggtaggcgtgtcgctcaaccgctccagt
ccgtttgccgagctgcagcgccaggccaagcgcggcatcctgacccatatcgcctcgctg
ggcgaatcggacagcgacaagatcaccgccgaaggcgatggcaagccggcgcaatcgaaa
cgcagcgaccaagaggtgaccttgtcgccgaatgtcatttcccatatcaagtaa

DBGET integrated database retrieval system