KEGG   Collimonas fungivorans: CFU_1747Help
Entry
CFU_1747          CDS       T01583                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
cfu  Collimonas fungivorans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CFU_1747 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFU_1747 (sdhD)
   00650 Butanoate metabolism
    CFU_1747 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    CFU_1747 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2065132..2065509
Genome map
AA seq 125 aa AA seqDB search
MADNNIGANIGPKRLVVGAHYGLRDWLAQRVTAVVMAVYTVILLVSFLTASNFSYDGWAG
LFSHQWFKLATFVTLMALFFHAWIGVRDVWMDYVKPVAVRLVLQVATILWLVGCAGWAAQ
ILWRV
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaacaatattggcgcgaatatcggtcctaagcgcctggtagtaggggcccat
tacggtttgcgcgactggctggcgcagcgcgttacagcagtggtcatggcggtctacacc
gtcatcctcctggtttctttcctcacagccagcaacttcagctatgacggctgggctggg
ctgttttcgcatcagtggttcaagctcgcgacattcgtgacgctgatggcgctgtttttc
cacgcctggatcggcgtgcgtgatgtctggatggattatgtcaagccggttgccgtgcgc
ctggtcttgcaagttgccacaatcctgtggttggtcggttgtgccggatgggcggcgcag
attttgtggagagtgtaa

DBGET integrated database retrieval system