KEGG   Collimonas fungivorans: CFU_1753Help
Entry
CFU_1753          CDS       T01583                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cfu  Collimonas fungivorans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:cfu01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cfu00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cfu00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2073137..2074396
Genome map
AA seq 419 aa AA seqDB search
MALLEVKVPQLSESVAEATLLTWHKKIGDAVKRDENLIDIETDKVVLELPAPADGVIVQL
IKGDGSTVVADEIIAVIDTDASAKVSPMEVAAVPVPQSGNAPTPVAAPELQSKSAAGIAM
PAAAKLLAENNLSAAQVDGSGKDGRVTKGDALGAIANKPAAPAPLAAAPAKPALQQVAAP
TKANLDDRPEERVPMSRLRARIAERLVQSQSTNAILTTFNEVNMQPVMDLRTKYKDKFEK
EHGVKLGFMSFFVKAAVAALKKYPIVNASVDGNDIVYHGYFDIGIAVGSPRGLVVPVLRD
ADQMSIADIEKKIGEFGAKAKDGKLTLDDLTGGTFSISNGGTFGSMLSTPIINPPQSAIL
GVHATKDRAVVENGQIVIRPMNYLAMSYDHRIIDGREAVLALVAMKEALEDPARLLLDL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggctcttctagaagtaaaagttccgcagctgtcggaatcggttgctgaagcgaccctg
ttgacatggcataaaaaaatcggcgatgctgtcaagcgcgacgagaacctgatcgatatc
gaaacagataaagtggtgctcgaactgccggcgccggcggacggcgtgatcgtccagctg
atcaagggcgacggcagcaccgtggtggcggatgaaatcatcgccgtgatcgataccgat
gcgtcggccaaggtcagcccgatggaagtggcagccgtgccggtgccgcaaagcggcaac
gcgccgacgccagtcgccgcgcctgaactgcaatcgaaatcggccgccggcatcgccatg
cctgccgcggcaaaactgctggcggaaaacaacctgtcggcggcgcaagtcgacggcagc
ggcaaggacggccgtgtcaccaagggcgacgccctgggcgccatcgccaacaagccggcc
gcgccggcgccgctggcagccgctccagccaagccggctctgcagcaagtcgcagcgccg
accaaggccaacctggacgaccgtccggaagagcgcgtgccgatgagccgcctgcgcgca
cggatcgccgagcgcctggtgcagtcgcaatcgaccaacgccatcctgacgacattcaat
gaagtcaacatgcagccggtgatggacctgcgcaccaagtacaaggacaagttcgaaaaa
gaacacggcgtcaagctgggtttcatgtcgttcttcgtcaaggctgcggttgcggcgctg
aagaaatacccgatcgtcaatgcctcggtggatggcaacgacatcgtctaccacggttat
ttcgacatcggcatcgcagtcggttcaccacgcggcctggtagtgccggtattgcgcgat
gccgaccagatgtcgatcgccgacatcgaaaagaaaatcggcgaattcggcgccaaggcc
aaggacggcaagctgacgctggacgacctgaccggcggtactttctcgatctcgaacggc
ggcactttcggttccatgctgtcgacgccgatcatcaacccgccgcagtcggcaatcctg
ggcgtgcatgcgaccaaggaccgcgcggtggttgaaaacggccagatcgtgatccgtccg
atgaactacctggcaatgtcttatgatcaccgtatcatcgatggtcgtgaagcggtgctg
gccctggtagcgatgaaagaagcgctggaagatccggcccgtctgttgctggacctgtaa

DBGET integrated database retrieval system