KEGG   Collimonas fungivorans: CFU_1784Help
Entry
CFU_1784          CDS       T01583                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cfu  Collimonas fungivorans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CFU_1784 (speB)
Enzymes [BR:cfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CFU_1784 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2107743..2109086
Genome map
AA seq 447 aa AA seqDB search
MQPRGAGRARARIGVATALDGRNARGGATVTTDYANHYRVHPRLRWELAGDGRVEMRLPF
GSKRLRAAESIATLLKRAAEEPPKTGDVLAQCLGTSVFETLVKYLFLLPESQADALGGGL
CIPAARPAGCALPVYDLDMLIEDDLVLLHVPIATTAEGKVSVASGGRWVRTHLAQSIESP
LGASARQGVLLDLDFGCQLDTASMRLFDVGDVVHQPLQDRASDIGERAAYVCRTIVTRGA
RPLILGGDHALAYYSVGALAQRYPRLGVLQIDAHPDLYTVGAVCDERLNHANVMHWVRRM
PHVLALWQVGVRDFFHQPTERVACVHDPKVQVLSAFEAETSGYQRLLDGMDPSLPWFVTF
DVDALALADYPQTATPVLGGLSLYPLLACFERLFHEFHIVGMEFVEIGDAPPEAHGTAAI
AARLASRYLFHLRKVTPTRDLLYSTIV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgcgtggtgcaggccgcgcacgcgcaaggattggcgtcgctacagccttggat
ggaagaaatgcgagaggaggcgctaccgtgacgaccgactacgctaatcactatcgcgta
cacccgcggctgcgctgggagctcgctggcgatgggcgggtcgagatgcgtctgccgttc
ggcagcaagcgtctacgtgcagctgaatccatcgcgacactgctgaaacgcgctgcagaa
gaaccgccgaaaactggcgatgtgctggctcagtgcctgggcaccagtgtgttcgagaca
ctggtgaagtacctcttcttgttgccagagagccaagcagacgcgcttggcggcggattg
tgcataccggctgcacggcccgccggatgcgcgttgccagtgtacgatctcgatatgctc
atcgaagacgatctggtgttgctacacgtgccaatcgctacaacggccgagggaaaagtc
tcggtggctagtggaggccgctgggtacgcacgcacttggctcagtcgattgagtcgccg
cttggggcatcggctcggcaaggagtattgttagacctcgattttggttgtcaactcgat
actgcgtcaatgcgcctgttcgatgtgggtgatgtggttcaccagccgctccaggatcga
gcgagcgacatcggcgaacgcgctgcttatgtgtgtcggacgatcgtcacccgcggagcg
cggccgttgatcttaggtggtgaccacgcgctagcctactacagcgtcggcgcgctggct
cagcgctacccgaggctgggggtgctgcagatcgatgcgcacccggatctatatacggtc
ggcgcagtctgcgatgaacggctcaatcacgccaacgtgatgcattgggtgcgccgcatg
ccgcacgtgctggcgctgtggcaggtaggggtgcgcgacttcttccatcagccgaccgaa
cgagttgcctgcgtgcacgatccgaaggtgcaagtactgtcagctttcgaggccgagacc
agcggctaccagcgacttctcgacggcatggatccgtccttgccctggtttgttacgttc
gacgtcgatgcgctcgcgctcgccgattatccgcagaccgctacacctgtgctcggcggg
ctcagcctttatccgttgctagcttgtttcgagcggctgtttcatgagtttcacatcgtc
ggcatggagttcgtcgagatcggtgatgcgccaccagaggcgcatggcaccgcggcgatc
gcggctcgcctagccagccgttacctctttcacctgcgtaaagtcacgcctacgcgggat
ctgctgtattcaacgatcgtctag

DBGET integrated database retrieval system