KEGG   Collimonas fungivorans: CFU_1873Help
Entry
CFU_1873          CDS       T01583                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cfu  Collimonas fungivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CFU_1873 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CFU_1873 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CFU_1873 (trpB)
Enzymes [BR:cfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CFU_1873 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2215788..2217050
Genome map
AA seq 420 aa AA seqDB search
MKEFTPLEQYAERQPLANTTLRQSAQYNLPDAKGHFGMYGGSFVSETLTLALSELQQAYA
KYQNEPQFLAEFHSELKHYVGRPSPIYHAKRWSEQMGGAQIYFKREDLNHTGAHKINNVI
GQALLAKRMGKPRVIAETGAGQHGVATATICARFGLECVVYMGSEDVKRQMQNVYRMNLL
GAKVVPVESGSKTLKDALNEAMRDWVTNVEDTFYIIGTVAGPHPYPMMVRDFQSVIGNEC
LVQMPEMTGRQPDHVVACVGGGSNAMGIFYPYINHHDVALVGVEAAGEGLASGKHSASLT
LGSPGVLHGNRTYLLQDANGQIIETHSISAGLDYPGVGPEHAWLKDCGRATYETVTDDEA
LAAFHTCCRIEGIIPALESSHALAYAAKLAATLPKDKIVLANLSGRGDKDMHTVAERLKL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattcacacccctcgagcagtacgccgagcgccagccgctcgccaataccacc
ttgcgccagagcgcccagtacaatctgccggacgccaagggccacttcggcatgtacggc
ggcagcttcgtgtcggaaaccctgacgctggcgctaagcgaactgcagcaggcttacgcc
aaatatcagaacgaaccgcagttcctggccgaattccacagcgagctgaaacattatgtc
ggccgtcccagtccgatctatcacgccaaacgctggtcggaacagatgggcggcgcgcag
atctacttcaagcgtgaagacctgaaccacaccggcgcccacaagatcaacaacgtcatc
ggccaggctttgctggccaagcgcatgggcaagccgcgcgtgatcgccgaaaccggcgcc
ggccagcacggcgtggcgacagctaccatctgcgcccgcttcggccttgagtgcgtggtg
tacatgggcagcgaagacgtcaagcgtcagatgcagaacgtgtaccgcatgaacctgctg
ggcgccaaggtggtgccggtcgaatccggctccaagaccttgaaggatgcgctcaacgaa
gccatgcgcgactgggtcaccaacgtcgaagacacgttctacatcatcggcacggtcgcc
ggcccgcatccgtatccgatgatggtgcgcgatttccagtcggtgatcggcaatgagtgc
ctggtgcagatgccggagatgaccgggcgccagccggatcacgtggtcgcctgcgtcggc
ggcggctcgaatgcgatggggattttttatccctatatcaatcatcacgacgtcgccctg
gtcggggtcgaagctgccggcgaaggcctggccagcggcaagcactcggcttcgctgacg
ctcggctcgcccggcgtgctgcatggcaaccgcacctacctgctgcaagacgccaacggc
cagatcatcgagacccattcgatttcggccggcctcgattatccgggcgtgggtccggaa
cacgcatggctcaaggactgcggccgcgctacctacgaaaccgtgaccgacgacgaggcg
ctggcggcgttccatacctgttgccgcatcgagggcatcatcccggcgctagaatcgagc
cacgccctggcgtatgcggccaagctggcggcaaccttgcccaaggataagattgtcctg
gccaatctgtcgggtcgcggcgacaaggacatgcataccgttgccgagcgcctgaagctc
taa

DBGET integrated database retrieval system