KEGG   Collimonas fungivorans: CFU_1874Help
Entry
CFU_1874          CDS       T01583                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cfu  Collimonas fungivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CFU_1874 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CFU_1874 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CFU_1874 (trpA)
Enzymes [BR:cfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CFU_1874 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2217115..2217912
Genome map
AA seq 265 aa AA seqDB search
MSRIQTTLAALAANNKKGLIPFITAGDPAPELTVPLMHALVRGGADILELGVPFSDPMAE
GPVIQRACERALKFGVSLHDVLAYVREFRQSNNSTPVVLMGYANPLERMGVDAFIAAAKE
AGVDGSIVVDYPPEECEEFAEKMQANGMDPIFLLAPTSTEERIMQVAKVSSGFTYYVSLK
GVTGAANIDTGEVAARVAAIRKHVKLPIGVGFGIRDAATAKAVAQVSDAVVIGSRIIQEL
ENTPREQAVAAVESFLSGIRKALDE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgaatccagactaccttggcagcgctcgctgcaaacaataaaaaaggcttgatc
cctttcattaccgccggcgatccggcgcccgagttgaccgtgccgctgatgcatgcgctg
gtcaggggcggcgccgacatcctcgagctgggcgtgccgttttccgatccgatggcagaa
ggcccggtgatccagcgcgcttgcgaacgggcgctgaaattcggcgtcagcctgcatgac
gtgctggcttatgtgcgcgaatttcggcagagcaacaacagcacgccggtggtgctgatg
gggtacgccaatccgctggaacggatgggcgtcgatgcatttattgctgctgcgaaagag
gccggagtcgacggcagcatcgtggtcgactatccgcctgaagagtgcgaagagtttgcc
gagaagatgcaggccaacggcatggatccgattttcctgctggcgccgacttcgaccgaa
gagcggattatgcaggtggccaaggtcagcagcggattcacgtattatgtgtccttgaag
ggcgtgactggcgccgccaacatcgataccggcgaagtcgcggcccgggtggcggcgatc
cgcaaacatgtcaaattgccaatcggcgtcggtttcggcatccgcgatgcggccactgcc
aaggccgtggcgcaagtgtcggacgcggtcgtgatcggcagccggatcatccaggaactg
gaaaatacgccgcgcgaacaggctgtagctgctgtggaaagcttcttgtcggggatcagg
aaagcgctggacgagtga

DBGET integrated database retrieval system