KEGG   Collimonas fungivorans: CFU_1907Help
Entry
CFU_1907          CDS       T01583                                 

Gene name
pcm2
Definition
putative L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cfu  Collimonas fungivorans
Brite
Enzymes [BR:cfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CFU_1907 (pcm2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2246824..2247702
Genome map
AA seq 292 aa AA seqDB search
MTEKAKRFPLTLSSLADKKPGTDQSKRSVATPQTATKNAAWENSRPPPRTAAGAPPLAPS
SKAMARPAQSASHVDRSGSMVSDGVRKAMVDRVARQGVSDAKVLAAMEAVPRHMFMEPGM
SSQAYIDASLPIGHHQTISQPYIVARMIEIMRDNQQGGVLNRVLEIGTGCGYQAAVLSLV
AKEVYSIERIKPLHELARSNLRPLRIGNIRLHYGDGMLGLPQVAPFDGIILAAAGLEVPQ
ALLDQMTIGGRLVAPVGARHQVLQLIQRTSKFDWTSTTLEDCHFVPLRAGTV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaaggccaagcgtttcccgctgacgctgtcgtcgctcgccgataagaagccc
ggcaccgaccagagcaaacgcagcgtagccacgccgcaaacggcaacaaaaaatgccgcc
tgggagaactcccggccgccgccgcgcactgccgccggcgcgccgccattggcgccgtcc
agcaaggcgatggcgcggccggcgcagagcgcaagccatgtcgaccgttccggctcgatg
gtttccgacggcgtgcgcaaagccatggtggaccgggtcgccaggcagggcgtcagcgac
gccaaggtgctggcggcgatggaagccgtgccgcgccacatgttcatggagccgggcatg
tcgagccaggcctacatcgatgcttcgctgccgatcggccaccatcagaccatttcgcag
ccgtatatcgtggcgcgcatgatagagatcatgcgcgacaaccagcaaggcggcgtcttg
aaccgggtgctggaaatcggcaccggctgcggttaccaggcggcggtgctgtcgctggtg
gcgaaggaagtctattcgatagagcggatcaagcccttgcacgaactggcaagaagcaac
ttgcgtccgctgcggatcggcaacatccgtttgcattacggagatggtatgcttgggctg
ccgcaggtagcgcctttcgacggtatcatcctggctgcagccggccttgaagtaccgcaa
gcattactggaccagatgacgatcggcggccgcctggtggccccggtcggcgcccgtcac
caggtattgcagctcatccagcgcaccagcaaatttgattggaccagcaccacactggaa
gactgtcattttgtgcctttgcgtgcaggaacggtttga

DBGET integrated database retrieval system