KEGG   Collimonas fungivorans: CFU_1997Help
Entry
CFU_1997          CDS       T01583                                 

Gene name
galU2
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cfu  Collimonas fungivorans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CFU_1997 (galU2)
   00052 Galactose metabolism
    CFU_1997 (galU2)
   00500 Starch and sucrose metabolism
    CFU_1997 (galU2)
   00520 Amino sugar and nucleotide sugar metabolism
    CFU_1997 (galU2)
Enzymes [BR:cfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CFU_1997 (galU2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2342679..2343623)
Genome map
AA seq 314 aa AA seqDB search
MPGRYLFAAPFFTNLSSRVISMHKKITKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLI
QYAVEEAAAAGITEMIFVTGRNKRAIEDHFDKAYELEAELLAKNKQALLEVLRQIKPKNV
ECFYVRQAEALGLGHAVLCAERLVHGEPFAVILADDLLDGTIPVMRQMTDLYADYGSSII
GVEAIAPVQSRSYGVVAGTAAGDRLHKLHGIVEKPAPEEAPSNLGVVGRYILNPSIFDHL
HTLQPGSGGELQLTDGIASLLAQEEVMAYQFEGTRYDCGSKLGYLQASVKFALKHPEVKE
EFREFLNNFIADKI
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
ttgccggggcgctacttgtttgcagcgcctttttttacaaacctatcttcaagagtcatc
agcatgcataaaaaaatcaccaaagccgtatttcccgtcgccggcctcggcactcggttc
ttgccggccaccaaggccagtcccaaggaaatgctgcccgtggtagacaagcccttgatc
cagtatgcggtggaggaagcggccgccgccggcatcaccgaaatgatttttgtcaccggc
cgcaacaaacgcgccatcgaagaccatttcgacaaagcctacgaactggaagccgaactg
ctggccaagaacaagcaggcgctgctggaagtgctgcgccagatcaagccgaagaatgtc
gaatgtttttatgtgcggcaggcggaagcgctgggcctgggccatgccgtcctgtgcgcc
gagcggctggtgcacggcgagccgtttgcggtaatcctggcggacgacctgctggatgga
acgatccctgtcatgcgccagatgaccgatctgtatgcggactatggcagcagcatcatc
ggcgtcgaggcaatcgcgccggtgcagagccgttcctacggcgtggtggccggcacggcg
gccggcgatcgcttgcacaaactgcacggaatcgtggaaaaaccggcgccggaagaggcc
ccttccaacctgggcgtggtcggacgctatatcctgaacccgtcgattttcgaccacctt
catacgctgcagccaggttctggcggcgaactgcagctgaccgacggcatcgcctcattg
ctggcgcaggaagaagtgatggcctaccagttcgaaggtacgcgctacgattgcggcagc
aagctcggctacctgcaagcctcggtaaaattcgcgctgaaacatcctgaagtcaaagag
gaattccgcgaattcctcaataacttcatcgccgacaagatctaa

DBGET integrated database retrieval system