KEGG   Collimonas fungivorans: CFU_2001Help
Entry
CFU_2001          CDS       T01583                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00071  Fatty acid degradation
cfu00280  Valine, leucine and isoleucine degradation
cfu00281  Geraniol degradation
cfu00310  Lysine degradation
cfu00360  Phenylalanine metabolism
cfu00362  Benzoate degradation
cfu00380  Tryptophan metabolism
cfu00410  beta-Alanine metabolism
cfu00627  Aminobenzoate degradation
cfu00640  Propanoate metabolism
cfu00650  Butanoate metabolism
cfu00903  Limonene and pinene degradation
cfu00930  Caprolactam degradation
cfu01100  Metabolic pathways
cfu01110  Biosynthesis of secondary metabolites
cfu01120  Microbial metabolism in diverse environments
cfu01130  Biosynthesis of antibiotics
cfu01212  Fatty acid metabolism
Module
cfu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CFU_2001
   00650 Butanoate metabolism
    CFU_2001
  Lipid metabolism
   00071 Fatty acid degradation
    CFU_2001
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFU_2001
   00310 Lysine degradation
    CFU_2001
   00360 Phenylalanine metabolism
    CFU_2001
   00380 Tryptophan metabolism
    CFU_2001
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CFU_2001
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CFU_2001
   00281 Geraniol degradation
    CFU_2001
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFU_2001
   00627 Aminobenzoate degradation
    CFU_2001
   00930 Caprolactam degradation
    CFU_2001
Enzymes [BR:cfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CFU_2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEK61832
UniProt: G0A8W9
Position
2350967..2351470
Genome map
AA seq 167 aa AA seqDB search
MALSKPXIAAINGCAVAGGLELALLADLRVADEDAVLGVFCRRWGVPLIDGGTVRLPRLV
GMGRALDLILTGRPVTAAEALAMGLVNRVTPPGAALAAAQELAREVAGFPQQCMLADRRS
AYEQWDLPLAEALRREGVQGVPIVFAEGEAGAARFTHGAGRHGRSED
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggctttgtcgaaaccgntgatcgccgccatcaatggctgcgccgtggcgggcggactg
gagctggcgctgctggccgatttgcgggtggctgacgaagacgccgtgctcggcgtgttt
tgccggcgctggggcgtgcccctgatcgacggcggcacggtgcgcctgccgcgcctggtc
ggcatgggccgtgcgctcgacctgatcctcaccggccggccggtaacggcggcggaagcc
ctggccatggggctggtcaatcgcgtcaccccgccaggcgccgcgctggcggcggcgcag
gagctggcgcgcgaggtcgccggttttccgcagcaatgcatgctggccgaccgccgttcc
gcgtatgagcagtgggacctgccgctggccgaggcgctgcgccgcgaaggcgttcaaggc
gtgccgattgtattcgccgaaggcgaggcgggggccgccaggttcacgcacggcgccggc
cgtcatggccgttccgaggactga

DBGET integrated database retrieval system