KEGG   Collimonas fungivorans: CFU_2312Help
Entry
CFU_2312          CDS       T01583                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cfu  Collimonas fungivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CFU_2312 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CFU_2312 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CFU_2312 (thrC)
Enzymes [BR:cfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CFU_2312 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2758727..2760187)
Genome map
AA seq 486 aa AA seqDB search
MHYVSTRGHAAAQNFSEILLGGLAPDGGLYLPEKYPQVTGAELDQWRGLSYADLAFEVLK
KFATDVPAADLKALAHKTYSAEVYRNARAGEDAGQITPLRLLEEKDGGKLLLQGLSNGPT
LAFKDMAMQLLGNLFEYTLAKNDAKLNIFGATSGDTGSAAEYAMRGKKGIRVFMLSPHKK
MSAFQTAQMFSLQDPNIFNIAVEGVFDDCQDMVKAVSNDHAFKASQKIGTVNSINWARVV
AQVVYYFRGYLSATTSNDQKVSFTVPSGNFGNICAGHIARMMGLPIDKLVAATNENDVLD
EFFRTGIYRVRKSAETYHTSSPSMDISKASNFERFIHDLLDGDSERVRALFHKVETAGGF
SLAGGPGSDGDEFAKIGRFGFQSGKSTHQDRLATIRDIEQRYGVTIDTHTADGVKVAREY
MVPGVPMIVLETALPAKFNETIREALGRDAERPAGFENIEALPQRFEVMAADVAQVKAFI
ASHTGL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcattatgtttccactcgcggccacgcagccgcgcaaaatttttccgaaatcctgtta
ggcgggctggccccggatggcggcctgtacctgcctgagaaatatccgcaagtcaccggc
gccgaactggatcaatggcgcggcctgtcgtatgccgacctggcgtttgaagtattgaag
aagtttgccactgacgtgccggccgccgatctgaaggcgctggcgcacaagacctacagc
gccgaggtgtaccgcaatgcgcgggcgggcgaagacgccggccagatcacgcccctgcgc
ctgctggaagaaaaggatggcggcaagctgctgctgcaaggcttgtcaaacggtccgacg
ctcgccttcaaggacatggcgatgcagttgctgggcaacctgttcgaatatacgctagcc
aagaacgacgccaagctgaacattttcggcgccacttccggcgataccggcagcgcagcg
gaatatgcgatgcgcggcaaaaaaggcatacgcgtgttcatgctgtcgccgcacaagaag
atgagcgcattccagaccgcgcagatgttcagcctgcaagatccgaacatcttcaatatc
gcggtcgaaggcgtgttcgacgactgccaggacatggtcaaggcggtgtccaacgatcac
gccttcaaggccagccagaagatcggcaccgtcaactcgatcaactgggcgcgcgtggtg
gcgcaggtggtgtattacttccgcggctacctgagcgcgaccaccagcaacgaccagaag
gtatcgttcacggtcccgtcaggcaatttcggcaatatctgcgccggccatatcgcgcgc
atgatgggtttgcccatcgataagctggtggcggccaccaacgaaaacgacgtgctcgac
gaatttttccgcaccggtatctaccgggtgcgcaagtcggccgagacctatcacaccagc
agccctagcatggatatcagcaaggcgtccaatttcgaacgtttcatccacgatttgctg
gatggcgacagcgagcgcgtgcgcgccttgttccacaaggtggaaaccgcaggcggcttc
agcctggcgggcggcccgggcagcgatggcgatgaatttgccaagatcggccgtttcggc
ttccagtccggcaagtcgacccatcaggaccgcttggccaccatccgcgatatcgaacag
cgctacggcgtcaccatcgacacccacaccgccgacggcgtcaaggtggcgcgcgaatac
atggtcccgggcgtgccgatgattgtgctggaaaccgccttgccggccaagttcaacgag
accatccgcgaagcgctgggacgcgacgccgagcggccggccggttttgaaaacatagaa
gcgctgccgcagcgtttcgaagtgatggcggccgacgtggcgcaggtgaaggccttcatc
gccagccataccggcttgtaa

DBGET integrated database retrieval system