KEGG   Collimonas fungivorans: CFU_2349Help
Entry
CFU_2349          CDS       T01583                                 

Gene name
est
Definition
esterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cfu  Collimonas fungivorans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2802331..2803131
Genome map
AA seq 266 aa AA seqDB search
MSVRTGALLIHGLGGTQFDLGSMHKVLQRAGVETHAVTLPGHGGQPEDLVPVSYEDWLDA
VTASYRELAPQYDTFHVMGMCLGSLLALALCERVQHSKGKLVTLAPPVFIDGWSTPWYRQ
LRHLVYCIPGVASRMKVEEDEPFGIKNATVRAIVKAKFARGDNFHYRWVPLACIRQVDRL
RRKVLAGAHRITCPTLVVHAREDELTSLKSAEFLQATLPDVRVVVLENSYHMICVDNDRE
QVTNSVLEFFGYPPAPPRRVRGADKT
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtccgcaccggcgccctgctgattcatggcctgggcggcacccaattcgatctc
ggctcgatgcacaaagtgctgcagcgcgccggcgtggaaacccacgccgtcaccctgccc
ggccacggcggacagccggaggacctggtgccggtcagctacgaggactggctcgatgcg
gtcaccgccagctatcgagaactggcgccgcaatacgacacgttccacgtgatgggcatg
tgcctgggttcgctgctggcgctggcgctgtgcgaacgggtgcagcacagcaaaggcaag
ctggtgacgctggcgccgccggtgttcatcgatggctggtcgacaccgtggtatcgccag
ctgcggcacctggtgtattgcattccgggtgtcgcaagcaggatgaaagtcgaggaagac
gaaccgttcggcatcaagaacgccacggtgcgcgccatcgtcaaggccaagttcgcgcgc
ggcgacaattttcattatcgctgggtgccgctggcttgcatccgccaggtcgaccgcctg
cgcaggaaggtgctggccggggcccacaggattacctgccccaccctggtggtgcatgcg
cgcgaagatgaactgaccagcctgaaatcggccgaattcctgcaggcgacgctaccggac
gtgcgcgtggtggtgctggaaaacagttaccacatgatttgcgtcgacaatgaccgcgag
caggtcaccaacagcgtgctggaatttttcggttatccgccggcgccgccgcggcgggtg
cgcggcgcagacaagacctga

DBGET integrated database retrieval system