KEGG   Collimonas fungivorans: CFU_2372Help
Entry
CFU_2372          CDS       T01583                                 

Gene name
cheB2
Definition
chemotaxis response regulator protein-glutamate methylesterase 4 (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
cfu  Collimonas fungivorans
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cfu02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2827526..2828584
Genome map
AA seq 352 aa AA seqDB search
MKIGIVNDAPIAVEALRRTLVQRQDHEIIWIAEDGQRAIELCAWQVPDLILMDLMMPVLD
GVAATRHIMAHTPCAILIVTGDVGANVSAVYDAMAYGALDAIDTPSTLSGYQRNDVNTML
AKIDSIEKLLNQRQSLPEQRAPAAAAVTTTAAAGAKRTSLPAPDSKYLIAIGASAGGPAA
LATLLSQLPADFPAALVVVQHVDAQFASGMAEWLSGQSKLPVRLAQAGDSPAPGQVLLAG
TDDHLRLTRPFQLGYTEQPSGYPYRPSIDVFFQSVVELWAGKAVGILLTGMGRDGALGLK
AMRDKGYYTIAQDRESSAVYGMPKAAALLDAADAILPVNQIAAKLVSIICKR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggtattgtcaacgatgcgccgattgcggtggaagcgctgcgccgcacgctg
gtccagcgccaggaccacgagatcatctggattgccgaggatggccagcgcgccattgag
ctgtgtgcatggcaggtgccggacctgatcctgatggacctgatgatgccggtgctggac
ggcgtcgccgccacccgccacatcatggcgcatacgccatgtgcgatcctgatcgtcacc
ggcgacgtcggcgccaatgtctcggcagtctatgatgccatggcttacggcgcgctggat
gcgatcgataccccgagcaccctgagcggttaccagcgcaacgacgtcaacaccatgctg
gccaagatcgactctatcgaaaaactgctcaaccagcgccagtcgctgccggaacagcgg
gcgccggctgccgcggcggtcaccacgactgccgccgccggcgctaaaagaacatcgctg
ccggcccccgactcaaaatacctgatcgccatcggcgcttccgccggcggtcccgcggcg
ctggccaccctgctgtcgcagctgccggccgatttcccggcggccctggtggtggtgcag
catgtggatgcccagttcgcttccggcatggccgaatggctcagcggccagtcgaaactg
ccggtgcggctggcgcaggccggcgacagcccggcgccaggccaggtgctgctggccggg
accgacgaccatctgcgcctgacccggccgttccagctcggctacaccgaacaacccagc
ggctatccctaccggccgtcgatcgacgtttttttccagagcgtggtcgaattgtgggcg
gggaaagcggtcggcatcctgctgaccggcatgggccgcgacggcgccctggggctcaaa
gccatgcgcgacaaaggttactacacgatcgcccaggaccgtgaatccagcgctgtgtat
ggcatgccgaaggcagccgccctgctcgatgcggccgacgccatcctgccggtgaaccag
atagcggcaaagctggtcagcatcatatgcaaacgataa

DBGET integrated database retrieval system