KEGG   Collimonas fungivorans: CFU_2418Help
Entry
CFU_2418          CDS       T01583                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
cfu  Collimonas fungivorans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CFU_2418 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFU_2418 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    CFU_2418 (aceB)
Enzymes [BR:cfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CFU_2418 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2880643..2882229)
Genome map
AA seq 528 aa AA seqDB search
MTQLTLPAGMEINGAIGAGYAEILTPEALALVAKLSRAFETRRQELLAVRVERAKRLDAG
ERPDFLPETAHIRNGDWKIAPIPAALECRRVEITGPVERKMVINAFNSGADSYMTDFEDS
NSPVWDNQITGQINLRDAIRKTISLEQNGKSYKLNDKVATLVVRPRGWHLDEKHVLIDGK
RVSGGIFDFALFMFHNAKEQLARGAGPYFYLPKLESHLEARLWNDIFVMTQNELGLPQGT
IKATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSCIKKFKLDKDFCLADRAKVT
MTAPFMRSYALLLLKTCHKRNAPAIGGMAALIPIKNDPEKNEIAMGGVRVDKARDATDGY
DGGWVAHPGLVELAMTEFKKVLGDKPNQISKQREDVNVSAADLLDFKPEAPITEAGLRYN
INVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRAQVWQWIRSTKGVLDDGKKVTAEMVV
AMIPQELVKVKALVGDGATYDRAARIFEEMSTSASFAEFLTLPLYEEI
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgactcaactgacactgccggccggtatggaaatcaacggcgccatcggcgccggatac
gcagaaattctgactcccgaagcgctggcgctggtcgccaagctgagccgcgcattcgaa
acgcgccgtcaggaattgctggcagtgcgggtcgagcgcgccaagcgcctggacgccggc
gagcgtcctgacttcctgcctgaaaccgcgcatatccgcaacggcgactggaagatcgcg
ccgatcccggccgcgctggaatgccgccgcgtcgaaattaccggcccggtcgagcgcaag
atggtgatcaacgccttcaactccggcgccgacagctacatgaccgacttcgaagattcg
aactcaccggtatgggataaccagatcaccggccagatcaacctgcgcgacgctatccgc
aagacgatttcgctggaacagaacggcaagtcctacaaactgaacgacaaggtcgcgacc
ctggtggtccgtccgcgcggctggcacctggatgaaaaacatgtgctgatcgacggcaag
cgcgtctccggcggcattttcgatttcgccctgttcatgttccacaacgccaaggaacag
ctggcgcgtggcgccggcccgtatttctacctgccgaagctggaatcgcacctggaagcg
cggctgtggaacgacatcttcgtgatgacccagaatgaactcggcctgccgcaaggcacg
atcaaggcgacagtcctgatcgaaaccatcctggccgctttcgaaatggacgagatcctg
tacgaactgcgcgagcacagctccggcctgaacgccggccgctgggattacatcttctcc
tgcatcaagaaattcaagctggacaaggacttctgcctggccgaccgcgccaaggtcacc
atgaccgcgccgttcatgcgttcgtatgccttgctgttgctgaagacctgccacaagcgc
aatgcgccggcgatcggcggcatggctgcgctgatcccgatcaagaacgatccggaaaag
aacgagatcgccatgggcggcgtgcgcgtcgacaaggcgcgcgacgccaccgacggctac
gacggcggctgggtggcccatccaggcctggtcgaactggccatgaccgagttcaagaag
gtattgggcgacaagccgaaccagatcagcaagcagcgcgaagacgtcaacgtcagcgcc
gccgacctgctcgacttcaagccggaagcgccgatcaccgaagccggcctgcgctacaac
atcaacgtcggcatccattacctgggcgcctggctggccggcaacggttgcgtgcctatc
cataacctgatggaagatgcggccaccgcggaaatcagccgtgcgcaagtatggcaatgg
atacgctcgaccaagggcgtgctcgacgacggcaagaaagtgaccgccgagatggtggtc
gcaatgattccgcaggagctggtcaaggtcaaggcgctggttggcgacggtgcaacgtat
gaccgcgctgccaggatcttcgaagaaatgtcgacttcggcgtcgtttgccgaattcctg
acgttgccgctgtacgaagaaatctaa

DBGET integrated database retrieval system