KEGG   Collimonas fungivorans: CFU_2567Help
Entry
CFU_2567          CDS       T01583                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00010  Glycolysis / Gluconeogenesis
cfu00030  Pentose phosphate pathway
cfu00051  Fructose and mannose metabolism
cfu00052  Galactose metabolism
cfu00680  Methane metabolism
cfu01100  Metabolic pathways
cfu01110  Biosynthesis of secondary metabolites
cfu01120  Microbial metabolism in diverse environments
cfu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFU_2567 (pfkA)
   00030 Pentose phosphate pathway
    CFU_2567 (pfkA)
   00051 Fructose and mannose metabolism
    CFU_2567 (pfkA)
   00052 Galactose metabolism
    CFU_2567 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CFU_2567 (pfkA)
Enzymes [BR:cfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CFU_2567 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CFU_2567 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEK62394
UniProt: G0A9D2
Position
3050175..3051407
Genome map
AA seq 410 aa AA seqDB search
MHPRRILIAQGGGPTAVINQSLAGVVLAARGVSDVDLVYGARNGVRGIVNEDFLDLGQET
AANLELVANTPSSALGSTRDKPDLKYCKEIIQVLQAHQINHFFYIGGNDSSDTLRILSLE
AEKLAFPLRCIHIPKTIDNDLVSNDHTPGFPSAARFVAQAFAGANLDNAALPGVYVGVVM
GRHAGFLTAASALGRKFADDGPHLIYLPERVFVLENFLADVKQAYQRFGRCVIAVSEGIH
DASGTPIASLLAKTVERDDHGNVQLSGNGALADLLCEEIKSKLNIKRVRGDTFGYLQRSF
MGCVSDVDQREAREVGEKALQFAINDQRNGTVAIKRSGAYSINYAVNYELLDLDVVAGKT
RVMEDELIAASGTDVTDAFRLYLQPLLGSGMPDGFRLRSPAVAKIRNVGG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcacccccgaagaatccttatcgcgcaaggcggcggaccgaccgccgtcatcaatcag
tccctggcgggagtagtgctggcggcgcgcggcgtgtccgatgtcgacctggtgtacggc
gcccgcaacggcgtgcgcggcatcgtcaacgaagatttcctcgacctcggccaggaaacc
gccgccaacctggagctggtggccaacaccccttcttccgcgctgggatcgacgcgcgac
aaacccgacctcaagtattgcaaggagatcatccaggtgctgcaggcgcaccagatcaat
cacttcttctacataggcggcaacgattcgtccgacaccctgcgcatcctcagcctggaa
gcggaaaagctggcctttcccctgcgctgcatccatattccgaagaccatcgacaacgac
ctggtcagcaacgatcacacgccgggtttcccatcggccgcgcgcttcgtggcgcaggcg
tttgccggcgccaacctggataacgccgccctgcctggggtttatgtcggcgtggtgatg
ggccggcatgccggcttcctgacggcggcctcagcgctgggcaggaaattcgccgacgac
gggccgcacctgatctacctgccggaacgggtcttcgtgctggaaaatttcctggccgat
gtgaagcaggcctaccagcgtttcggccgctgcgtgatcgctgtctcggaaggcatacac
gatgcatccggcacgcctatcgccagcctgctggccaagacggtggagcgcgacgaccat
ggcaacgtgcagctatccggcaacggcgccctggccgacctgctgtgcgaagagatcaaa
tcgaaactgaacatcaagcgcgtgcgcggcgacaccttcggctacctgcagcgctcgttc
atgggttgcgtctcggatgtggaccagcgcgaagcgcgcgaggtcggtgaaaaagcgctg
cagtttgccatcaacgaccagcgcaacggcactgtcgccatcaagcgcagcggcgcctat
tcgatcaactacgcagtcaactatgaattgctggacctggatgtggtggcaggcaagacc
cgggtcatggaagacgagctgatcgccgccagcggcaccgacgtcaccgacgccttccgg
ctttacctgcagccgctgctaggctcgggcatgccggacggtttccggctgcgctcgcct
gccgtcgcaaaaatacggaacgtcggcggctga

DBGET integrated database retrieval system