KEGG   Collimonas fungivorans: CFU_2567Help
Entry
CFU_2567          CDS       T01583                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cfu  Collimonas fungivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CFU_2567 (pfkA)
   01230 Biosynthesis of amino acids
    CFU_2567 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFU_2567 (pfkA)
   00030 Pentose phosphate pathway
    CFU_2567 (pfkA)
   00051 Fructose and mannose metabolism
    CFU_2567 (pfkA)
   00052 Galactose metabolism
    CFU_2567 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CFU_2567 (pfkA)
Enzymes [BR:cfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CFU_2567 (pfkA)
Protein phosphatases and associated proteins [BR:cfu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CFU_2567 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3050175..3051407
Genome map
AA seq 410 aa AA seqDB search
MHPRRILIAQGGGPTAVINQSLAGVVLAARGVSDVDLVYGARNGVRGIVNEDFLDLGQET
AANLELVANTPSSALGSTRDKPDLKYCKEIIQVLQAHQINHFFYIGGNDSSDTLRILSLE
AEKLAFPLRCIHIPKTIDNDLVSNDHTPGFPSAARFVAQAFAGANLDNAALPGVYVGVVM
GRHAGFLTAASALGRKFADDGPHLIYLPERVFVLENFLADVKQAYQRFGRCVIAVSEGIH
DASGTPIASLLAKTVERDDHGNVQLSGNGALADLLCEEIKSKLNIKRVRGDTFGYLQRSF
MGCVSDVDQREAREVGEKALQFAINDQRNGTVAIKRSGAYSINYAVNYELLDLDVVAGKT
RVMEDELIAASGTDVTDAFRLYLQPLLGSGMPDGFRLRSPAVAKIRNVGG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcacccccgaagaatccttatcgcgcaaggcggcggaccgaccgccgtcatcaatcag
tccctggcgggagtagtgctggcggcgcgcggcgtgtccgatgtcgacctggtgtacggc
gcccgcaacggcgtgcgcggcatcgtcaacgaagatttcctcgacctcggccaggaaacc
gccgccaacctggagctggtggccaacaccccttcttccgcgctgggatcgacgcgcgac
aaacccgacctcaagtattgcaaggagatcatccaggtgctgcaggcgcaccagatcaat
cacttcttctacataggcggcaacgattcgtccgacaccctgcgcatcctcagcctggaa
gcggaaaagctggcctttcccctgcgctgcatccatattccgaagaccatcgacaacgac
ctggtcagcaacgatcacacgccgggtttcccatcggccgcgcgcttcgtggcgcaggcg
tttgccggcgccaacctggataacgccgccctgcctggggtttatgtcggcgtggtgatg
ggccggcatgccggcttcctgacggcggcctcagcgctgggcaggaaattcgccgacgac
gggccgcacctgatctacctgccggaacgggtcttcgtgctggaaaatttcctggccgat
gtgaagcaggcctaccagcgtttcggccgctgcgtgatcgctgtctcggaaggcatacac
gatgcatccggcacgcctatcgccagcctgctggccaagacggtggagcgcgacgaccat
ggcaacgtgcagctatccggcaacggcgccctggccgacctgctgtgcgaagagatcaaa
tcgaaactgaacatcaagcgcgtgcgcggcgacaccttcggctacctgcagcgctcgttc
atgggttgcgtctcggatgtggaccagcgcgaagcgcgcgaggtcggtgaaaaagcgctg
cagtttgccatcaacgaccagcgcaacggcactgtcgccatcaagcgcagcggcgcctat
tcgatcaactacgcagtcaactatgaattgctggacctggatgtggtggcaggcaagacc
cgggtcatggaagacgagctgatcgccgccagcggcaccgacgtcaccgacgccttccgg
ctttacctgcagccgctgctaggctcgggcatgccggacggtttccggctgcgctcgcct
gccgtcgcaaaaatacggaacgtcggcggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system