KEGG   Collimonas fungivorans: CFU_2567Help
Entry
CFU_2567          CDS       T01583                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cfu  Collimonas fungivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cfu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cfu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cfu00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cfu00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cfu00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cfu00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cfu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3050175..3051407
Genome map
AA seq 410 aa AA seqDB search
MHPRRILIAQGGGPTAVINQSLAGVVLAARGVSDVDLVYGARNGVRGIVNEDFLDLGQET
AANLELVANTPSSALGSTRDKPDLKYCKEIIQVLQAHQINHFFYIGGNDSSDTLRILSLE
AEKLAFPLRCIHIPKTIDNDLVSNDHTPGFPSAARFVAQAFAGANLDNAALPGVYVGVVM
GRHAGFLTAASALGRKFADDGPHLIYLPERVFVLENFLADVKQAYQRFGRCVIAVSEGIH
DASGTPIASLLAKTVERDDHGNVQLSGNGALADLLCEEIKSKLNIKRVRGDTFGYLQRSF
MGCVSDVDQREAREVGEKALQFAINDQRNGTVAIKRSGAYSINYAVNYELLDLDVVAGKT
RVMEDELIAASGTDVTDAFRLYLQPLLGSGMPDGFRLRSPAVAKIRNVGG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcacccccgaagaatccttatcgcgcaaggcggcggaccgaccgccgtcatcaatcag
tccctggcgggagtagtgctggcggcgcgcggcgtgtccgatgtcgacctggtgtacggc
gcccgcaacggcgtgcgcggcatcgtcaacgaagatttcctcgacctcggccaggaaacc
gccgccaacctggagctggtggccaacaccccttcttccgcgctgggatcgacgcgcgac
aaacccgacctcaagtattgcaaggagatcatccaggtgctgcaggcgcaccagatcaat
cacttcttctacataggcggcaacgattcgtccgacaccctgcgcatcctcagcctggaa
gcggaaaagctggcctttcccctgcgctgcatccatattccgaagaccatcgacaacgac
ctggtcagcaacgatcacacgccgggtttcccatcggccgcgcgcttcgtggcgcaggcg
tttgccggcgccaacctggataacgccgccctgcctggggtttatgtcggcgtggtgatg
ggccggcatgccggcttcctgacggcggcctcagcgctgggcaggaaattcgccgacgac
gggccgcacctgatctacctgccggaacgggtcttcgtgctggaaaatttcctggccgat
gtgaagcaggcctaccagcgtttcggccgctgcgtgatcgctgtctcggaaggcatacac
gatgcatccggcacgcctatcgccagcctgctggccaagacggtggagcgcgacgaccat
ggcaacgtgcagctatccggcaacggcgccctggccgacctgctgtgcgaagagatcaaa
tcgaaactgaacatcaagcgcgtgcgcggcgacaccttcggctacctgcagcgctcgttc
atgggttgcgtctcggatgtggaccagcgcgaagcgcgcgaggtcggtgaaaaagcgctg
cagtttgccatcaacgaccagcgcaacggcactgtcgccatcaagcgcagcggcgcctat
tcgatcaactacgcagtcaactatgaattgctggacctggatgtggtggcaggcaagacc
cgggtcatggaagacgagctgatcgccgccagcggcaccgacgtcaccgacgccttccgg
ctttacctgcagccgctgctaggctcgggcatgccggacggtttccggctgcgctcgcct
gccgtcgcaaaaatacggaacgtcggcggctga

DBGET integrated database retrieval system