KEGG   Collimonas fungivorans: CFU_2724Help
Entry
CFU_2724          CDS       T01583                                 

Gene name
pmm
Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00010  Glycolysis / Gluconeogenesis
cfu00030  Pentose phosphate pathway
cfu00051  Fructose and mannose metabolism
cfu00052  Galactose metabolism
cfu00230  Purine metabolism
cfu00500  Starch and sucrose metabolism
cfu00520  Amino sugar and nucleotide sugar metabolism
cfu00521  Streptomycin biosynthesis
cfu01100  Metabolic pathways
cfu01110  Biosynthesis of secondary metabolites
cfu01120  Microbial metabolism in diverse environments
cfu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFU_2724 (pmm)
   00030 Pentose phosphate pathway
    CFU_2724 (pmm)
   00051 Fructose and mannose metabolism
    CFU_2724 (pmm)
   00052 Galactose metabolism
    CFU_2724 (pmm)
   00500 Starch and sucrose metabolism
    CFU_2724 (pmm)
   00520 Amino sugar and nucleotide sugar metabolism
    CFU_2724 (pmm)
  Nucleotide metabolism
   00230 Purine metabolism
    CFU_2724 (pmm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CFU_2724 (pmm)
Enzymes [BR:cfu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CFU_2724 (pmm)
    5.4.2.8  phosphomannomutase
     CFU_2724 (pmm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AEK62551
UniProt: G0AHE5
Position
complement(3243244..3244635)
Genome map
AA seq 463 aa AA seqDB search
MLPIQNSIFKAYDIRGIVGKTLDAGIARQIGQAFGTAARAKGEKTVIIGRDGRLSGPELA
TALAAGLRDAGVDVVDLGLVATPMVYFATHVLGAQSGIMVTGSHNPPDYNGFKMVLAGEA
IYGETIQQLYQAIEDGSVEATISVPSGSYRQHDIRQAYLQRIVSDTKLARQMKIVVDCGN
GVAGAFAGELYRALGCEVQELFCEVDGTFPNHHPDPAHPENLQDVIRALQNSDAEIGLAF
DGDGDRLGVVTKDGQIIYPDRQLMLFAADVLTRHPGREILYDVKCTRHLAPWITAHGGKP
LMWKTGHSLVKAKMRETGAPLGGEMSGHVFFKDHWYGFDDGLYAGVRLLELLSRESDPSA
VLNALPQSSSTPELQLKLEEGENFSLIEKLQGEATFPGADDIIKIDGLRVEYPDGFGLAR
SSNTTPVIVMRFEAESPSALLRIQAEFKRVILAVKPDAALPFP
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgctcccgattcaaaattccatattcaaggcttacgacattcgcggcatcgtcggtaaa
accctggacgccggcatcgcgcgccagatcggccaggccttcggcaccgccgcccgggcc
aagggcgaaaaaacggtgattatcggccgcgacggccgtttatccggacctgaacttgcc
accgccctggctgccggcttgcgcgatgccggtgtggatgtggtcgatctgggcttggta
gcgacgcctatggtgtattttgcgacccatgtactgggcgcacagtccggcatcatggtc
accggcagccataatccgcctgattacaacggcttcaagatggtgctggcaggcgaggcg
atatatggcgagaccatccagcagctgtaccaggccatcgaagacggcagcgtcgaggca
accatatctgtgccaagcggcagctaccgccagcacgacatccggcaggcttatctgcag
cgcatcgtcagcgacaccaagctggcgcggcagatgaagatcgtggtcgattgcggcaac
ggcgtcgccggcgcttttgccggcgagctgtaccgtgcgctcggctgcgaggtgcaagaa
ctattctgcgaagtggacggcactttccccaaccaccatcccgatccggcccatccggag
aacctgcaggacgtgatccgcgccctgcaaaattcggacgccgaaatcggcctggccttc
gacggcgatggcgaccgcctcggcgtggtcaccaaggatggccagatcatctatccggac
cggcagctgatgctgtttgccgcggacgtgctgacacgccatccgggccgcgagatcctg
tacgacgtcaaatgcacgcgccacctggcgccgtggattaccgcgcatggcggcaagccg
ctgatgtggaagaccggccattcgctggtcaaggccaagatgcgtgaaaccggggcgccg
ctgggcggcgagatgagcggccatgtgttcttcaaggaccactggtacggtttcgacgac
ggcctgtacgctggcgtgcgcctgctggaactgctgagccgcgaaagcgatccgtcggcg
gtgttgaacgcgttgccgcaatcgtccagcacgcccgagctgcagctgaaactggaagaa
ggggagaacttcagcctgatcgaaaaactgcaaggcgaggcgacattccccggcgccgac
gacatcatcaaaatcgacggcctgcgtgtcgaatatccggacggcttcggcctggcgcgc
tcatccaataccacgccggtgatcgtgatgcgcttcgaagccgagtcgccatcggcgctg
ctgcgcatacaggcggaattcaagcgcgtaatcctggccgtcaagccggatgcggcgctg
cctttcccgtag

DBGET integrated database retrieval system