KEGG   Collimonas fungivorans: CFU_2730Help
Entry
CFU_2730          CDS       T01583                                 

Gene name
egl
Definition
putative endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cfu  Collimonas fungivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CFU_2730 (egl)
Enzymes [BR:cfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CFU_2730 (egl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3250546..3251553)
Genome map
AA seq 335 aa AA seqDB search
MIKFLFSALTLACALSGQASFAACMDGKPMAGVNLSGAEFAAEKLPGKVFTDYVYPDLDE
MRLFQSMGMNTFRLPFLWERVQPKLFGELDQAELQRIKDSVAAASSIGVCMILDVHNYGQ
YRGQPIGSPQVPRAALTDLWQRLLANFKDPANVAFGLMNEPAKLPTAEWAATAQETLNAL
RRKGSRHLILVPGGGWSGAHSWYAKDGVVSNADAFRFFRDPADNYMIEVHQYADANFSGT
GNECVEPAGLSAIMANVALWATSTRRRLFLGEFGVPANQQCLAALTAMMDAIKGNSAWGG
WTYWAAGQWLGTYPFSVQPDGNGERPQMTILKKGM
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaattcctgttctccgcattgaccctggcgtgcgccttgtctggccaggcttcg
ttcgccgcttgcatggacggcaagccgatggccggcgtcaacctgagcggcgccgaattc
gccgcggaaaaactgcccggcaaggtatttaccgactacgtgtacccggacctggatgaa
atgcgcctgttccaatccatgggcatgaacaccttccgcctgccgtttctgtgggagagg
gtgcagccgaagctgttcggcgaactggaccaggccgaactgcagcgtatcaaggatagc
gttgcagccgccagttcgattggcgtgtgcatgatcctcgatgtgcacaactatggccaa
tatcgcggtcagcctatcggttcgccgcaagtgccgcgcgcggccctgaccgacctttgg
cagcgcctgctggccaatttcaaggatccggcgaacgtcgccttcggcttgatgaacgaa
ccggccaaactaccgaccgcggaatgggcggcaaccgcgcaggaaacgctgaacgccttg
cgcaggaaaggctcgcggcacctgatcctggttcccggcggcggctggagcggcgcccat
tcctggtacgcaaaagacggcgtggtgtcgaatgcagacgctttccgtttctttcgtgat
cccgccgataactacatgatcgaagtgcatcagtacgcggacgcgaatttttccggcacc
ggcaacgagtgcgtggagccggccggcctgagcgcaatcatggccaacgtcgccctgtgg
gccacttcgacccggcgccgcctgtttcttggcgaattcggggtgccggccaaccagcag
tgcctggcggccttgacggcaatgatggatgccatcaagggcaattccgcctggggcggc
tggacctattgggccgccgggcagtggctggggacttatccgttcagcgtgcagcccgac
ggcaacggcgaacggccgcaaatgaccatcctgaaaaaaggcatgtag

DBGET integrated database retrieval system