KEGG   Collimonas fungivorans: CFU_2980Help
Entry
CFU_2980          CDS       T01583                                 

Gene name
hexI
Definition
N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cfu  Collimonas fungivorans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CFU_2980 (hexI)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CFU_2980 (hexI)
Enzymes [BR:cfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CFU_2980 (hexI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3518574..3520139)
Genome map
AA seq 521 aa AA seqDB search
MSSTDSKSDPQGKLGAARRIAGQLIMIRMPGTVLDEDTAQFLRDNHIRAVCLFRQNMVNP
EQLAKLTADLRAVMGPNALIGIDQEGGAVVRATWLPAPPAAMALGAVDDVALARSVGAAV
ARGIRSLGFNWNFAPVLDLNNNPANPVIGERSFGSDPQRATELALAWMEGSLEQGVACCV
KHFPGHGDTHVDSHRDLPTVAKPRSALDALELAPFKAARRAPAMMSAHIVYPALDPEYPA
TLSRKILTDLLRSEWDYRGVIITDGMDMHAIAGRYGVGNAAVRALAAGADMVMALGNRST
QEETLVSLTMALATAEEHGDLGSATVAARLARLDGLAAAYPCAAGAYLTESADELLMAEA
WRRGLTVAGQPQRLADGAKIRLVACADAAGDGVAEAGLPAEAVSALLARRYDVELVTFDD
EDKFDWASLPADGRTVILASTTRLRYGEKARKTWRPDLHLVLWNPFQILDIAAPALVTYG
FAAAALEAVADWLGGTLEARGKMPVPVTSNVDPLRPQRQLT
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcaccgatagcaaatccgatccccagggcaaactgggcgcggcgcgccgcatc
gccgggcagctgatcatgatccgcatgccgggcacggtgctggacgaggacactgcgcaa
tttttacgcgacaaccatatccgtgcggtctgcctgttccgccagaacatggtgaacccc
gaacagctggccaaactgaccgccgacctgcgcgcggtgatgggaccgaacgccctgata
ggcatcgaccaggaaggcggcgccgtggtgcgcgctacctggctgccggcgccgccggcg
gcgatggccttgggagcggtcgacgatgtggcgctggcgcgatctgtcggcgccgcggtc
gcgcgcggcatccggtcgctcgggttcaactggaatttcgcgccggtgctggatctcaac
aacaatcccgccaatccggtcatcggcgagcgctccttcggctccgatccgcaacgcgcc
accgaactggcgctggcctggatggagggcagcctggagcagggcgtggcttgctgcgtc
aagcatttccccgggcatggcgacacccatgtcgattcgcaccgcgacctgccgacggta
gccaagccgcgcagcgcgctggatgcgctggagctggcgccgttcaaggcggcgcgaagg
gcgcctgccatgatgagtgcccatatcgtctacccggcgctggaccccgaatatccggcg
accttgtcgcgcaagatcctgaccgacctgctgcgcagcgaatgggattaccgcggcgtc
atcattaccgacggcatggacatgcacgcgatcgccggccgctacggcgtcggcaatgcg
gcggtgcgagccttggccgccggcgccgacatggtcatggcgctgggcaatcgcagcacg
caagaagaaaccctggtgtccctgacgatggcattggctaccgccgaggagcatggcgat
cttggcagcgccacggtcgccgcccggctggcgcggctggatggcctggcggccgcctat
ccctgtgcggccggcgcttatctcaccgaatctgccgatgaattgctgatggccgaagcc
tggcgccgcggcctgaccgtggcaggccagccgcaacgccttgccgacggcgcaaaaatc
cgcctggtcgcttgcgccgatgcggccggcgacggcgtcgccgaagcaggtttaccggcc
gaggcggtgtctgccttgctggcgcgccgctacgatgtcgaactggtgactttcgacgac
gaagacaaatttgattgggcctcgctgccggctgacggcaggacggtgatcctcgcttcg
accacgcgtttgcgctacggcgaaaaagccaggaagacctggcgccccgatctgcacctg
gtgctgtggaatccgttccagatactggatatcgcggcgccggcgctggtcacttacggt
tttgccgcagcggcgctggaggctgtcgccgactggctgggcggaaccctcgaagcgcgc
ggcaagatgccggtgccggtaaccagcaacgttgacccactgcgcccacagcggcaactg
acatga

DBGET integrated database retrieval system