KEGG   Collimonas fungivorans: CFU_3208Help
Entry
CFU_3208          CDS       T01583                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00790  Folate biosynthesis
cfu01100  Metabolic pathways
Module
cfu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CFU_3208 (folE)
Enzymes [BR:cfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CFU_3208 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AEK63032
UniProt: G0AA98
Position
complement(3761197..3761907)
Genome map
AA seq 236 aa AA seqDB search
MRCSNAIAELHCRHQPKCIEQVKFLEKGKQMSSKDPVPAASALSERPSRAEAESAIRTLL
RWAGDDPDREGLLDTPARVARAYEEFFAGYSKDPVEILSTTFSEVEGYDEMVVLTNIRFE
SHCEHHMAPIIGKAHVAYLPDRRVVGISKLARLVDIFAKRLQIQEKMTVQIADTLQQVLL
PKGVAVVIEASHECMTTRGIHKPGTSLVTSRMLGAFRDDPSTRREFMSIISQKHGE
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcgatgcagtaatgccatagctgaattacactgtcggcatcagccgaaatgtattgag
caagtaaaatttttagaaaaaggtaaacagatgtcctcaaaagatccagtaccggcggct
agcgccttgtcagaacgtccaagccgcgccgaggcggaatcggcgatccgcaccctgctg
cgctgggccggcgacgatcctgaccgcgaaggcctgctggatacgccggcgcgcgtggcg
cgggcttatgaagaattttttgccggttacagcaaggacccggtggaaatcctctcgacc
actttttcggaagtcgagggctacgacgagatggtggtgctgaccaatatccgtttcgag
agccattgcgaacaccatatggcgccgattatcggcaaggcccacgtggcttacctgccg
gaccggcgcgtggtcggcatttcgaaactggcgcggctggtcgacatcttcgccaagcgt
ttgcagatccaggaaaaaatgacggtgcagattgccgataccttgcagcaggtgctgctg
ccgaaaggcgtggcggtagtgatcgaagcgtcgcatgaatgcatgaccacgcgcggcatc
cacaaaccaggcaccagcctggtgaccagccgcatgctgggcgcgttccgcgacgatccg
tcgacgcggcgcgagttcatgagcatcatcagccaaaagcacggcgaataa

DBGET integrated database retrieval system