KEGG   Collimonas fungivorans: CFU_3297Help
Entry
CFU_3297          CDS       T01583                                 

Definition
alcohol dehydrogenase (EC:1.1.1.14)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
cfu  Collimonas fungivorans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CFU_3297
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFU_3297
  Lipid metabolism
   00071 Fatty acid degradation
    CFU_3297
  Amino acid metabolism
   00350 Tyrosine metabolism
    CFU_3297
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CFU_3297
   00626 Naphthalene degradation
    CFU_3297
Enzymes [BR:cfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CFU_3297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3856438..3857511
Genome map
AA seq 357 aa AA seqDB search
MKAWMFNRAELTLALQETPQPELRAGAALVRMEAVPLLSYTRSYLKGELPYAYPPGTFTP
GTNGIGRITAVGAGVQQFRPGQRVAINPYWIANEAVAEPPQILIGLTGISLDSAQMLQEF
PHGSLREVADVPASTLLPLDGLDHLSSERLAVLAKFVVPFGGLRRGRLAAGETVAINGAG
GYFGSAAVLAALALGAAKVIALGRRPEALRKLVELGRGRVLPVLLSGDSSADAAAIRAAA
GGGVELAFDMVGKAGDAHSTLALLRSLRRGGRLVLMGSMQVPLPIPYGDMLLNSWELIGH
FMYTPADYLALLSLIRAGLLSLDDIEVKSFAFPDLEQAMDHAAQMQGLQATVTLFAQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatggatgttcaatcgcgccgaactgacgctggcgttgcaagaaacaccacaa
ccggagctgcgtgccggcgccgcgctggtgcgcatggaagcggtgccgctgctgagttat
acccgcagttacctgaagggcgaattgccctacgcctatccgcccggcaccttcacgccc
ggcaccaacggcatcggtcgtatcaccgccgtcggcgccggcgtgcagcagttccggccg
ggacagcgggtcgccatcaatccttactggatcgccaacgaagcagtagccgaaccgccg
caaatcctgatcggcctgaccggcatcagcctggacagcgcgcagatgctccaggaattc
ccgcatggcagcctgcgtgaagtggccgacgttccggcttccaccctgctgccgctggat
ggactcgatcacctgagcagcgaacggctggcggtgctggcgaaattcgtggtgccgttc
ggcggcctgcgccgcggccgcctggccgccggtgaaacggtggccatcaacggcgccggc
ggctattttggttcggcggcggtgctggccgcactggcgctgggcgcggctaaagtcatc
gcgctgggacgccgccccgaagcgctccgcaaactggtggaattaggccgtggcagagtg
ttgccggtgctgctttcgggcgacagcagcgccgatgcggcagcgatccgggccgcggcc
ggcggcggcgtcgagctggctttcgacatggtcggcaaggctggcgacgcccacagcacg
ctggcgctgctgcgcagcttgcggcgcggcggccggctggtgctgatggggagcatgcaa
gtgcccctgccgataccttacggcgacatgctgctcaacagttgggaactgatcggccat
ttcatgtatacgccagccgactacctggcgctgctgtcgctgatcagggccgggctgttg
tcgctggacgacattgaagtgaaaagcttcgccttcccggacctggaacaggccatggac
catgctgcccaaatgcagggattacaggcgacagtcacgctttttgcgcagtga

DBGET integrated database retrieval system