KEGG   Collimonas fungivorans: CFU_3558Help
Entry
CFU_3558          CDS       T01583                                 

Gene name
aceF
Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00010  Glycolysis / Gluconeogenesis
cfu00020  Citrate cycle (TCA cycle)
cfu00620  Pyruvate metabolism
cfu01100  Metabolic pathways
cfu01110  Biosynthesis of secondary metabolites
cfu01120  Microbial metabolism in diverse environments
cfu01130  Biosynthesis of antibiotics
cfu01200  Carbon metabolism
Module
cfu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFU_3558 (aceF)
   00020 Citrate cycle (TCA cycle)
    CFU_3558 (aceF)
   00620 Pyruvate metabolism
    CFU_3558 (aceF)
Enzymes [BR:cfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CFU_3558 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C GCV_H RnfC_N HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AEK63382
UniProt: G0ADC0
Position
complement(4148957..4150285)
Genome map
AA seq 442 aa AA seqDB search
MSMVEVKVPDIGDVSEVEVIELMVKVGDTVKVDQSLITVESDKASMEIPSSHAGVIKELK
VKLGDKVKEGTLVLVLEADAAAAAPASAAAAAPAAAPAAAAPALAPVAENKPAPAAPAPA
PVAAPAPAGGSIPHASPSVRKFARELGVDLSKVAGTGIKARITHEDVQNYVKGVISGAAS
GSAAAAGGKGGSGVGLDLLAWPSLDFSKQGPTELLPLSRIKKLSGPNLHRNWVMIPHVTQ
FDEADITELEEFRKQANDSFAKAKSPVKLTMLAFVIKASVAALKKFPAFNASLDGKGENL
ILKRYYNIGFAADTPNGLVVPVIKDADKKGISQIAQEMGELSAQARDGKLKPADMQGATF
TISSLGGIGGTAFTPIINAPEVAILGLSKASMKPVWDGKQFVPRLMMPTSLSYDHRVVDG
AMGARFSVYLAEVLADMRKTLL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggtggaagtcaaagtcccggatatcggcgacgtcagtgaagttgaagtcatt
gaattgatggtcaaggtcggcgacacggtaaaggtcgaccagtcgctgatcacggtcgaa
tccgacaaggccagcatggaaatcccgtccagccatgcgggcgtgatcaaggaattgaaa
gtcaagctgggcgacaaggtcaaggaaggcactttggtgctggtgctggaagccgatgct
gccgcagcggcgccggctagtgccgcggccgccgcaccagctgcggcgcctgcagcagcc
gctccggctcttgcgccagtcgcggaaaacaagccagcgccggccgctcccgcgccggca
ccggtagcagctccggcgccagccggcggcagcatcccgcatgcgtcgccgtcggtgcgc
aagttcgcgcgcgaactgggcgtcgacctgagcaaagtggccggcaccggcatcaaggcc
cgcatcacccacgaagatgtgcagaattacgtcaagggcgtgatttccggcgcggccagc
ggcagcgcagctgctgcgggcggcaagggcggcagcggcgtcggcctcgacctgctggca
tggccgtcgctggatttcagcaagcagggaccgaccgaattgctgccgctgtcgcgcatc
aagaagctcagcggcccgaacctgcatcgcaactgggtcatgatcccgcacgtcacgcaa
ttcgacgaagccgatatcaccgaactggaagaattccgcaagcaagccaacgacagcttc
gccaaggccaagtcgccagtcaagctgaccatgctggcgttcgtgatcaaggccagcgtc
gccgcgctgaagaaattcccggcgttcaacgcctcgctcgacggcaagggcgaaaacctg
atcctcaagcggtactacaacatcggctttgctgccgatacgccgaacggcctggtggtg
ccggtgatcaaggatgccgacaaaaaaggcatcagccagatcgcccaggaaatgggcgag
ttgtccgcacaggcgcgcgacggcaagctgaaaccggccgacatgcaaggcgcaaccttc
acgatttcatcgctgggcggcatcggcggtacggcgttcacgcctatcatcaatgcccct
gaagtcgccatcctgggtttgtcgaaagcctcgatgaaaccggtctgggacggcaagcag
ttcgtgccgcgcctgatgatgccgacctccctgtcctacgaccatcgcgtggtcgacggc
gccatgggtgcgcgctttagcgtctacctggccgaagtgctggccgacatgcgcaagaca
ttgttgtaa

DBGET integrated database retrieval system