KEGG   Collimonas fungivorans: CFU_3648Help
Entry
CFU_3648          CDS       T01583                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00790  Folate biosynthesis
cfu01100  Metabolic pathways
cfu02020  Two-component system
Module
cfu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CFU_3648
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CFU_3648
Enzymes [BR:cfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CFU_3648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N TAT_signal Pur_ac_phosph_N Metallophos UCR_Fe-S_N
Motif
Other DBs
NCBI-ProteinID: AEK63472
UniProt: G0AAU8
Position
4263639..4265255
Genome map
AA seq 538 aa AA seqDB search
MSSSNSPAFKRRNFLRTAAAGAGVLLTGAPLHKAIAQSGAPALVTSDRLRPQLPSGVMSG
DITRDKAIIWSRADRPSRMVVEYASNENFQDAHTLQGPLALSGSDYSARVDLTGLPSGQT
VFYRVRFQDIQNPSVYSAPLSGSLLIPGGAERDITFAFSGDEAGQGWGINEAWGGYRIYE
TMRRFKPDFFIHSGDQIYADGVIEKEVRLDDGTLWQNLVTPAKSKVAETLDDYRGNFAYN
LLDANKLRFAAEVPFLVQWDDHEVRNNWYPGQKIGAAEKRYQERDLSTLAVNAKRAMFEY
NPFRIEPSDPERVYRMFNYGPLLEVFMLDERSYRGANSSNRQGVLTQDAAFLGAAQLRWI
KQALLRSRSTWKVIASDMPISIVVPDLNPDVPQGTFEAWANNDHGKPLGRELEVADLLKF
IKQHDIKNVVWVTADVHYASATYYMPEKASFTDFKPFWEFVGGPLHAGTFGPGEIDRTFG
PDVRYVSIPSDMKQNRPPSELLQFFGVGKIDAKSKVMTVSLHDIDGKDLFKIDLHPEV
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccagcaattcccctgccttcaaacgccgcaatttcctgcgcaccgccgctgcc
ggcgccggcgtgctgctgaccggcgcgccgctgcacaaggccatcgcgcagagcggcgcg
ccggccctggttacttcggaccggctgcggccgcaactgcccagcggcgtgatgagcggc
gacattacgcgcgacaaggcgattatctggagccgcgccgaccgcccctcgcgcatggtg
gtggagtacgccagcaacgaaaatttccaggatgcgcatacgctgcaagggccgctggcc
ctttccggcagcgactattcggccagggtcgacctcaccggcctgcccagcggacaaacc
gtcttttatcgcgtgcgcttccaggacatccagaatccgtcggtctacagcgcaccgctg
agcggcagcctgctgatccccggcggcgccgagcgcgacatcactttcgccttctccggc
gacgaggccggccaaggctggggcatcaacgaggcctggggcggctaccggatctatgaa
acgatgcgccgcttcaaacccgattttttcattcactcaggcgaccagatctacgccgac
ggcgtcatcgaaaaagaagtcaggctggacgacggcacgctctggcaaaacctggtgacg
ccggccaagtccaaggtagccgaaacgctggacgactatcgcggcaattttgcctataac
ctgctggacgccaacaagctccgcttcgccgcggaagtgccgttcctggtgcaatgggac
gaccacgaggtgcgcaacaactggtatccgggccagaaaatcggcgcggcggaaaaacgc
taccaggaacgcgacctgtcgaccttggccgtcaacgccaagcgggcgatgttcgaatat
aacccgttccggatcgaacccagcgatcccgaacgggtttaccgcatgttcaactacggc
ccgctgctggaagtgttcatgctcgacgaacgcagctaccgcggcgccaactccagcaac
cgccagggcgtcctgacgcaggatgcggcttttctcggcgccgcccaattgcgctggatc
aaacaggctttgctgcgctcgcgctcgacctggaaagtgatcgccagcgacatgccgatc
tcgatcgtggtgccggacctcaacccggatgtgccgcaaggcacgttcgaggcctgggcc
aacaacgaccacggcaagccgctcggacgcgagctggaagtggccgacctgctcaagttc
atcaagcagcacgacatcaagaacgtggtgtgggtcaccgccgatgtgcactacgcttcg
gccacctactacatgcccgagaaagccagcttcaccgacttcaagccgttctgggaattc
gtcggcggcccgctgcatgccggtactttcggtccgggcgaaatcgaccgcactttcggc
cccgacgtgcgctacgtcagcatccccagcgacatgaaacagaaccgcccgcccagcgag
ctgctgcaattcttcggcgtcggcaagatcgacgccaaaagcaaggtcatgacggtatcc
ctgcacgacatcgacggcaaggacctgttcaagatcgacctccatcccgaggtgtag

DBGET integrated database retrieval system