KEGG   Collimonas fungivorans: CFU_4064Help
Entry
CFU_4064          CDS       T01583                                 

Gene name
gpmA
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cfu  Collimonas fungivorans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CFU_4064 (gpmA)
   01230 Biosynthesis of amino acids
    CFU_4064 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFU_4064 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CFU_4064 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CFU_4064 (gpmA)
Enzymes [BR:cfu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CFU_4064 (gpmA)
Exosome [BR:cfu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CFU_4064 (gpmA)
  Exosomal proteins of melanoma cells
   CFU_4064 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4760508..4761254
Genome map
AA seq 248 aa AA seqDB search
MYKLVLMRHGESTWNLANRFTGWVDVDLTEKGVAEARQAGQLLKEAGFTFDLAYTSVLKR
AIRTLWGTLDEMDLMWLPVRHHWRLNERHYGALQGLNKAETAAKYGDEQVMVWRRSYDTP
PMPLEPGDPRTSYDDPRYAGLKREEIPLTECLKDTVARVLPFWNDEIAPSIRSGKRIIIS
AHGNSLRALIKMLDGISDQDIVGLNIPNGQPLVYELDADLKPIKSYYLGDQAAIAAAMNA
VASQGKAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgtattgatgcgccacggcgaatccacctggaacctggctaaccgcttc
accggctgggtcgacgtcgaccttaccgaaaaaggcgtggctgaagctaggcaggcaggc
cagctgctgaaagaagccggtttcactttcgacctggcctacacctcggtactgaaacgc
gcgatccgcaccctgtggggcacgctcgacgagatggacctgatgtggctgccggtcagg
catcactggcgcctgaacgaacgccactatggcgccctgcaaggcttgaacaaggcggaa
accgcggccaaatacggcgacgaacaggtcatggtgtggcgccgcagctatgacacgccg
ccgatgccgctggaaccgggcgatccgcgcacttcctacgacgatccgcgctacgccggc
ctgaaacgcgaggaaatcccactgaccgaatgcctgaaagatacggtagcgcgcgtcttg
ccgttctggaacgatgaaatcgcaccgtccatccgcagcggcaagcgcatcatcatttca
gcccatggcaacagcctgcgcgccctgatcaagatgctggacggcatcagcgaccaggac
atcgtcggccttaacatccccaacggccagccattggtatacgaactggacgccgacctg
aaaccgatcaagagctattaccttggcgaccaggcggcgatagcagcggcgatgaacgcc
gtcgccagccaggggaaagcgaaataa

DBGET integrated database retrieval system