KEGG   Collimonas fungivorans: CFU_4068Help
Entry
CFU_4068          CDS       T01583                                 

Gene name
phoD
Definition
alkaline phosphatase (EC:3.1.4.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cfu  Collimonas fungivorans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cfu00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cfu00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cfu02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4765348..4767150
Genome map
AA seq 600 aa AA seqDB search
MKRRQFLKGSAFFTVVAASTGLLSACGGSTSDGSTGKFAFPQGIASGDPKENSIVFWARV
VRNNGAIAADAIAVRLEVSATPDFSALAAQANLNAVADYDFTVRAKITQLKPDTAYYYRF
TAGSDVSVVAQTKTAPLASASNSQVRFAWFTCQDWSVNHWQAMSLLAQENLDFVVHVGDY
IYETVGASFQTGGAEPAHQPITLPNGLAHPGGGVYANTVNDYRTLYRTYKTDARLQGIHH
KFPVIAIWDDHEFSDDCWQDHQVYTNQNKQETTRRRSATQAWAEYTPIDFGDLSFDLNNS
SYQNIRIYRDFRFGQLVHLVMTDERLYRDDHIVSEQSVAQQAGHDPVNGDDSIGARYFVP
RATLLQMEAQETAKLGRPPSILGTTQTQWWKDTLKNSDATWKVWGNEIMLNRMWADLSPP
ALGIPAPYNQLYVINCDSWDGYPSHKAELLSYLDTQNIKNVVAITGDLHAFQCGVVRANP
ADPGSTPVLVDFLAAGISSQSFYNYIKSGAATVNPLLGALVQTPQIFDSLLKGFNPDFAY
VDHDAQGYASATVTSDNIVVVFNKVKPLAADNSAPQQPLLKRTRITLAKGSTIPQIEDNI
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcagacagtttttgaagggttcggcattttttacggtggttgcggcaagcacg
ggattgctgagcgcatgcggcggcagcaccagcgatggcagcacggggaaattcgcgttt
cctcagggcattgcttctggcgacccgaaggaaaacagcatagtgttctgggcccgcgta
gtgcgcaacaatggcgccatcgccgcagatgcaattgccgtacggctggaagtctcggcc
acgccagacttttccgctctggctgcgcaagccaacctaaacgccgtcgccgactatgac
ttcacggtgcgcgcgaaaataacgcagctcaagcccgacaccgcttattactaccgtttt
accgccggcagcgacgtcagcgtagtcgcccagaccaaaaccgcgccgctcgccagcgcc
agcaacagccaggtgcgcttcgcctggttcacctgccaggactggtcggtcaaccactgg
caggccatgtccctgctggcgcaggaaaacctggattttgtggtgcacgtcggcgactac
atctacgaaaccgtgggtgcttcattccagaccggcggcgccgaaccggcgcaccagccg
atcaccttgcccaacggcctggcccacccgggcggcggcgtgtacgccaatacggtcaac
gattaccgcaccctgtaccgcacttacaagaccgacgcgcgcctgcagggcatccatcac
aaattcccggtgattgcgatctgggacgaccacgaattctccgacgactgctggcaggac
caccaggtctacaccaaccagaacaagcaggaaacgacgcgccggcgcagcgccacccaa
gcctgggccgaatacacgcctatcgatttcggcgacctgtcgttcgacctcaacaacagc
agctaccagaacatccgcatctaccgcgatttccgcttcggccagctggtgcacctggtg
atgaccgacgagcgcctgtaccgggacgaccacatcgtcagcgaacagtcggtggcgcag
caggccgggcatgatccggtcaacggcgacgattcgataggcgcacgctacttcgtgccg
cgcgccaccctgctgcagatggaagcgcaggaaaccgccaagctgggacgaccgccgtcg
atactcggcaccacccagacgcaatggtggaaagacaccctgaagaattcggacgcaacc
tggaaagtatggggcaatgaaatcatgctgaaccgcatgtgggctgacctgtcgccgccg
gcgctgggcatcccggcgccctacaaccagctgtatgtgatcaactgcgattcatgggac
ggttatcccagccacaaggccgagctgctgtcttacctggatacgcaaaacatcaagaac
gtggtggccatcacaggcgacctgcatgccttccagtgcggcgtggtgcgcgccaatccg
gccgatccgggcagcaccccggtgctggtggatttcctggcggcaggcatcagcagccag
tcgttttacaactacatcaaatccggcgcggcgacagtcaatcccttgctcggcgcgctg
gtgcagacgccgcagatcttcgacagcctgttaaagggattcaatcccgactttgcctac
gtcgaccacgatgcccagggctacgcctcggccaccgtgaccagcgacaacattgtagtg
gtgttcaacaaggtgaaaccgctcgccgcggataacagcgcgccgcagcaaccgttgttg
aaacgcacccgcatcacgctggcaaagggttcgaccattccgcaaatcgaagacaacatc
tga

DBGET integrated database retrieval system