KEGG   Collimonas fungivorans: CFU_4098Help
Entry
CFU_4098          CDS       T01583                                 

Gene name
rbsK2
Definition
(GenBank) Ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
cfu  Collimonas fungivorans
Pathway
cfu00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CFU_4098 (rbsK2)
Enzymes [BR:cfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CFU_4098 (rbsK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AEK63920
UniProt: G0AFB2
Position
complement(4796313..4797239)
Genome map
AA seq 308 aa AA seqDB search
MIVIIGSINMDLVLNVPRMPLPGETLSGGRFQTISGGKGANQAVACARLSDDSVKVAMVA
CLGDDAFGTELRAALRNDGIDDSHISTIAGEASGVASILVDAGGQNSIVLAAGANDALSP
AHIDAARSLIEQARIVVLQLETPLATVIHAIKLAHQLGKTVVLNPAPAPAPAQALPAALL
AQVDYLIPNEIEAAMLAGLSAASLDNDAAIEAAVAKLRADGSSNVLVTLGEKGVYAALSS
GSVHFAAQQTKAVDTTAAGDTFIGGFVAALAEGRSEADAIAFGQRAAALSVARIGAQTSI
PYRRELEA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcatcatcggcagtatcaatatggacctggtgctcaacgtgccgcgcatgccg
ctccccggcgaaaccttgtcgggcgggcgtttccagaccatctcgggcggcaagggcgca
aaccaggcggtcgcttgcgcgcgtctcagcgacgatagcgtgaaagtggcgatggttgcc
tgcctcggcgacgacgctttcggtacggaactgcgggctgccttgcgcaacgacggcatc
gacgacagccatatcagtacgatagcaggagaagcttcgggcgtggcttcgatcctggtc
gacgccggcggccagaacagcatcgtgctggccgccggcgccaatgacgcgttgagcccg
gcacatatcgatgccgcgcgcagcctgatcgaacaggcgcgtatcgtcgtgctgcagctg
gaaacgccgctggcgacagtgatccatgcgatcaagctggcgcatcagctgggcaagacc
gtggtgcttaatccagcacctgcgccggcaccggcgcaagccttgccggccgctttgctg
gcgcaggtggattatctgatcccgaatgaaatcgaggcagccatgctggccggcctgagc
gccgccagtttggataacgatgccgccatcgaggcagcagtcgcaaaattgcgcgccgat
ggcagcagcaatgtgctggtcacgctgggtgagaagggtgtctatgcggcgctgtcgtcc
ggctcggtccattttgccgcgcagcagaccaaggcggtcgacaccaccgccgccggcgac
accttcattggcggttttgtcgccgcgctggccgaaggccgcagcgaagccgacgccatc
gcttttggccagcgcgcggctgccctgagcgtggcgcgcatcggcgcgcaaacctcgatt
ccctatcgccgtgaattggaagcttga

DBGET integrated database retrieval system