KEGG   Collimonas fungivorans: CFU_4374Help
Entry
CFU_4374          CDS       T01583                                 

Gene name
speB2
Definition
Agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cfu  Collimonas fungivorans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CFU_4374 (speB2)
Enzymes [BR:cfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CFU_4374 (speB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5097484..5098437
Genome map
AA seq 317 aa AA seqDB search
MSETPLYQPLGGNDMPRFGGIATMMRLPHVASSAELDACFVGVPFDLGTSNRSGTRFGPR
QMRTESVLLRPYNMATRAAPFDALRIADLGDVAINPYNLLDSIRLIETAYDSIVASGCRP
ISLGGDHTIALPILRALHRKYGKIGLIHVDAHADVNDTMFGEKIAHGTPFRRAVEEGLLD
CQRVVQIGLRGTGYTAEDFDWCRDQGFKVVQVEECWNKSLAPLMEEVRARLAGGPVYLSF
DIDGIDPAYAPGTGTPEIAGLTVPQALEIIRGAWGLDIVGADLVEVSPPYDPVGTTALLG
ANLAYEMLCVLPGVPRR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaaccccactttaccaaccgctaggcggcaacgacatgccgcgtttcggcggc
atcgccaccatgatgcgtttgccgcacgtcgccagcagcgcggaactggacgcctgtttt
gtcggcgtgccgttcgacctcggcacctcgaaccgctccggcacccgcttcggcccgcgc
cagatgcgtaccgaatcggtgctgctgcggccctacaacatggcgacccgcgccgcgcct
ttcgacgcgctgcgcatcgccgacctcggcgacgtcgccatcaatccctacaacctgctc
gattcgatcaggctgatcgagaccgcttacgacagcatcgtcgcctccggctgccgcccg
atttcgctgggcggcgaccataccatcgcgctgcccatcctgcgcgccctgcatcgcaaa
tacggcaagatcggcctgatccacgtcgacgcccatgccgacgtcaacgacaccatgttc
ggtgaaaagatcgcgcacggcacgccgttccggcgcgcggtggaagaaggcttgctggat
tgccagcgcgtggtgcagatcggcttgcgcggcaccggctacaccgcggaagatttcgac
tggtgccgcgaccagggtttcaaggtggtgcaggtggaagagtgctggaacaaatcgctg
gcgccgctgatggaagaagtgcgggcccgcctggccggcggcccggtctacctcagcttc
gacatcgacggcatcgacccggcctatgcgcccggcaccggcaccccggaaatcgccggc
ctgaccgtgccgcaggcgctggaaatcatccgcggcgcctggggcctggacatcgtcggc
gccgacctggtcgaagtgtcgccgccttacgacccggtcggcaccactgccctgctgggc
gccaatcttgcgtatgaaatgctatgcgtgctgccgggcgtgccgcgccgctag

DBGET integrated database retrieval system