KEGG   Chlamydia trachomatis F/SW5: FSW5_0561Help
Entry
FSW5_0561         CDS       T02166                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cfw  Chlamydia trachomatis F/SW5
Pathway
cfw00020  Citrate cycle (TCA cycle)
cfw00310  Lysine degradation
cfw01100  Metabolic pathways
cfw01110  Biosynthesis of secondary metabolites
cfw01120  Microbial metabolism in diverse environments
cfw01130  Biosynthesis of antibiotics
cfw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cfw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FSW5_0561 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    FSW5_0561 (sucB)
Enzymes [BR:cfw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FSW5_0561 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: CCE14109
Position
64270..65367
Genome map
AA seq 365 aa AA seqDB search
MSIEVRIPNIAESISEVTISALLIPSGGLVQENQGILEIESDKVNQLIYAPCSGRVEWSV
SVGDTVAVGSVVGIISEAEKSQDTAPIHEQMPFSLVEQESDAQIIAFPSSVRQDPPAEGK
TFVPLKEIQPASSDHRESRESMSAIRKTISRRLVQSLHDSAMLTTFNEIHMGPLIALRKE
RQEDFVAKYGVKLGFMSFFVRAVVDSLKKYPRVNAYIEDNEIVYRHYYDISIAIGTDRGL
VVPVIRNCDQLSSGEIELQLADLASRAREGKLAIHELEGGGFTITNGGVYGSLLSTPIIN
PPQAGILGMHKIEKRPVVREDAIVIADMMYVAMSYDHRIIDGKEAVGFLVNVKEQLEQPE
LLLKM
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagaggttcgtattcccaatatcgcagaatccattagtgaagtgacgatttct
gcacttttgattccatcaggaggtttggtgcaggagaatcaagggattctggagatagag
agtgacaaggtgaatcagctcatttacgctccttgctcaggaagggtagagtggagcgtt
tccgtaggggatacggtcgctgttggtagtgttgtagggattattagtgaagcggaaaag
agtcaagatactgcacctatccatgagcagatgccatttagtcttgtagagcaggaaagc
gatgcgcagattattgccttcccttcatcagtgagacaggatcctcctgcagaagggaaa
acttttgttccattaaaggagattcaaccagcttcttctgatcatagagaatctcgagaa
tctatgagtgctattcggaagacgatttctcgtagattggtgcaatctctacatgattca
gcaatgttaacgacatttaatgaaatccatatggggccgcttattgctctgcgtaaggaa
agacaagaagatttcgttgcgaagtatggggtaaaactggggttcatgtctttctttgtt
agagccgttgtagattctttgaaaaaatatccccgggtgaatgcttatattgaagataac
gaaatcgtttacagacattactacgatatttccattgccatagggacagatcgtggatta
gtagttcctgtaattcgtaattgtgatcagttatctagcggggagattgagttacagctt
gccgatttagcttctcgtgctcgggaaggcaaacttgctattcatgagttagaaggggga
ggcttcactattaccaatggaggggtatacggttctcttctatccactcccattatcaat
cctccacaggcaggtattcttgggatgcacaagatagagaaacgccctgtggttagagaa
gatgcaattgtgatagccgatatgatgtatgtagctatgagctatgatcatcggattata
gacggaaaggaagccgtaggatttcttgtgaatgttaaagagcaattagaacaacccgag
cttttgctaaaaatgtag

DBGET integrated database retrieval system