KEGG   Chlamydia trachomatis F/SW5: FSW5_7861Help
Entry
FSW5_7861         CDS       T02166                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cfw  Chlamydia trachomatis F/SW5
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cfw00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(908455..909483)
Genome map
AA seq 342 aa AA seqDB search
MFSLLNDCQKAAETVVMQAMLSLMRYRKAHKFIPFWKKPDQTYVTPADYAIQYYFYQKLT
SLFPHIPLVGEETLNPATDHPRIPQILQFAQQLDPKVSCQDLYQALSPESSHSSLFWLTD
PIDGTSGFIKQRCFAIALSLFYEHTPVLSVIACPSSKNNSFKIYSAAKGEGLTICNPTHS
FPFSLHEDFQPTCKFCEASLSARNHQHLATHILSKHLPWNPQPIRADSQCKYAWVADNTV
DFFIRIPYSPPRAHYRDHAPGVFLIEEAGGLVTDISGNPLPFSNPNLYLDRHPLILASAN
EQMHSTILETLYKLRHQATQNMLPLAAHVSATKHKQLSALQL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgttctccctcctcaatgactgccaaaaagctgcggaaacagttgtcatgcaggctatg
ctgtcactgatgcgctatcgaaaagctcataaatttattcccttttggaaaaagcctgac
cagacatacgttactcccgctgattacgctatccaatattatttttaccaaaaactgaca
tctttatttccgcatatcccgctggtcggagaagaaactctcaatcctgccacggatcac
cctaggatccctcaaatcctacaatttgcgcagcagctcgatcccaaagtctcctgtcaa
gatttgtatcaggccctctctccggaaagctcccactcttcactattttggttaacggac
cctatcgacggtacttcgggattcatcaaacaacgttgtttcgccatcgctctttctcta
ttttacgaacatacccctgttctctccgttatcgcttgcccttcttccaaaaataactct
ttcaaaatctattcggcagccaaaggcgaaggacttacgatttgtaatcctacccattcc
ttccccttctccctgcacgaagatttccagcctacctgtaaattctgtgaagcctcctta
tcagctagaaaccatcaacatttagctacacatattctcagtaaacatctcccttggaat
cctcagcctatccgagcagatagtcaatgcaaatacgcttgggttgcagataatacggta
gacttcttcattcgcatcccgtattcccctccacgagcccactacagagaccatgctcct
ggtgtgtttcttatagaagaagctggaggcctcgttacagatatatcggggaatcctctc
cctttttctaatccaaatttatatctagatagacatcctttgattcttgcttctgctaac
gagcaaatgcatagcacgattttagagactctatacaaactacgtcaccaagctactcaa
aacatgctcccccttgccgctcatgtctctgctactaagcataaacagctaagcgctctt
caactatag

DBGET integrated database retrieval system