KEGG   Chlamydia trachomatis F/SW5: FSW5_8171Help
Entry
FSW5_8171         CDS       T02166                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cfw  Chlamydia trachomatis F/SW5
Pathway
cfw00900  Terpenoid backbone biosynthesis
cfw01100  Metabolic pathways
cfw01110  Biosynthesis of secondary metabolites
cfw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cfw00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FSW5_8171 (ispE)
Enzymes [BR:cfw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     FSW5_8171 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: CCE14868
Position
940675..941541
Genome map
AA seq 288 aa AA seqDB search
MHFLSPAKLNLFLQILGRREDDFHEIVTRYQAIAFGDQFSLSISSRDSLQVINACHLETP
SNSIWKSVALFRRYTGITTPVSWRVVKQIPVGAGLAGGSSNAATALFALNQIFKTGLSDE
EMRSLAEQIGMDTPFFFSTGAALGVARGEKIIALEESVSDRYVLYFSSEGVLTSRAFAAV
QPSDCSSRKNLEYTQNDLEKPVFRLRLDLKEKKHWLESLWAELPVHIGLTGSGATLFVRY
PEILEEDPSYAAQIQRAVTLSGGLLTSPIRRDPTAWYSIYSESALAAT
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcactttctttctccagcaaagcttaatctctttttgcagatacttggcaggcgggaa
gatgattttcatgaaatagtcacacgctatcaagcgatagcctttggggatcaattctcc
ttatcaataagctctcgcgattctctccaagtaattaatgcttgtcatcttgaaacgcct
agtaattctatatggaaaagtgtggcgcttttccgtcggtacacaggcattacaacgcct
gttagttggcgtgtagtcaaacagatccctgttggagcaggtcttgcaggagggagtagt
aatgcagcaactgcattgtttgctttaaaccaaatcttcaaaacaggactatctgatgag
gaaatgcgttccttagccgaacagattggcatggatactccttttttcttttctacagga
gcagccttaggagtggcccgtggggagaaaataatagctctagaagagagtgtttcagat
agatatgttttgtatttttctagtgaaggagttctcactagtcgggcttttgccgccgta
caaccttcggactgttcctccagaaaaaatttagagtatacgcaaaatgacttagaaaag
cctgtttttcggttgcgcttagatttgaaagaaaagaaacattggctagaaagcctgtgg
gcggaacttcctgtgcatatagggctaacgggatcaggggcaaccttatttgtccgttac
ccagaaatcttagaggaagacccttcttatgcagctcagatacaaagagcagtaacgtta
agcggaggattattgacttctccgatacgaagagatcctacagcttggtatagcatctat
tctgaaagtgcacttgcagctacataa

DBGET integrated database retrieval system