KEGG   Cellulomonas gilvus: Celgi_0154Help
Entry
Celgi_0154        CDS       T01537                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
cga  Cellulomonas gilvus
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Celgi_0154
Enzymes [BR:cga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Celgi_0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
170265..171983
Genome map
AA seq 572 aa AA seqDB search
MARADDARPHVVVVGSGFGGSVAALRLSEKGYRVTVLEAGRRFTPETLPRTSWDVRRFLW
APRLGCRGIQRIHVLPDVVVLAGAGVGGGSLVYANTLYEPTSDAFWGDPQWAGITDWRDE
LAPYFDQARRMLGVVTNPTTTPADRVVLAAARDLGVADTFVPAPVGVVFGPPGEPVPDPF
FGGAGPERRGCLECGECMTGCRHGAKNTLETNYLWLAERLGARIVPDTTVTSVRPVGAGW
EVRTVPTGRRGPVTTTRADQVVLAAGTWGTQSLLHRLKADGTLPGLSDRLGVSTRTNSEA
LGGAVRRVRGHRRTPPVNTGVAITSSVWLDEHTHLEPVRYGRGSNLMGLLGTVLTDGGGR
VPRPVRWLGQVLRHPVRVVTVLTGLGSWSERTVIGLVMQTGDASLTLAPRRTWRGGWRLT
STRGAGERPPTWIPQANAAFRRMAVHLGGAPMSSLGEVVDVPMTAHFMGGCAIGASAEQG
VVDAYHRVFGHPGLHVLDGSTISANLGVNPSLTITAQAERACAMWPRAGEPDPRPPVGEP
YRCVPAVAPLHPAVPAHAPAALRLTVVRRPTA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgagcggacgacgcgcggccgcacgtggtggtggtcggttccgggttcggcggc
tcggtggccgcgctgcgcctgtccgagaagggctaccgcgtcacggtcctggaggccgga
cggcggttcacgcccgagaccctgccgcgcacgtcgtgggacgtgcggcggttcctgtgg
gcaccccggctgggctgccgcggcatccagcgcatccacgtgctgccggacgtcgtggtc
ctcgcgggtgcgggggtcgggggcggctcgctggtctacgccaacacgctctacgagccg
acgtcggacgcgttctggggcgacccgcagtgggccggcatcaccgactggcgcgacgag
ctcgcgccgtacttcgaccaggcacgccggatgctgggcgtggtcaccaacccgacgacc
acgcccgcggaccgcgtggtgctcgccgcggcccgggacctgggggtggcggacacgttc
gtccccgcgcccgtcggcgtggtgttcgggcccccgggcgagcccgtgcccgacccgttc
ttcggcggtgccggcccggagcgccggggctgcctggagtgcggcgagtgcatgacgggg
tgccggcacggggccaagaacacgctcgagaccaactacctgtggctcgccgaacggctg
ggtgcgcgcatcgtgcccgacaccaccgtgacctcggtgcggcccgtcggcgccggctgg
gaggtgcgcaccgtcccgacgggacggcggggaccggtcacgacgacgcgcgcggaccag
gtggtgctcgcggccgggacgtggggcacgcagtcgctgctgcaccggctcaaggcggac
gggacgctcccggggctctcggaccggctgggcgtctcgacgcgcaccaactccgaggcg
ctgggcggcgccgtccgccgcgtgcgcgggcaccggcgcacgccaccggtgaacacgggt
gtggccatcacgtcctcggtgtggctcgacgagcacacccacctggagcccgtgcggtac
gggcgcgggtccaacctcatgggcctgctgggcaccgtgctgacggacggcggcggccgc
gtaccgcggcccgtgcgctggctcggccaggtgctgcgccacccggtgcgcgtggtgacg
gtgctgaccgggctgggctcgtggtccgagcggaccgtgatcgggctggtcatgcagacc
ggcgacgcgtccctgacgctcgcgccgcgccggacctggcggggcgggtggcgcctgacc
tcgacgcgcggcgcgggtgagcgcccgccgacgtggatcccgcaggcgaacgccgcgttc
cgccgcatggccgtccacctgggcggcgcgcccatgagcagcctcggggaggtggtcgac
gtgccgatgaccgcgcacttcatgggtggctgcgcgatcggggcgagtgcggagcagggg
gtggtggacgcctaccaccgcgtgttcgggcacccgggcctgcacgtcctcgacggctcg
accatctccgcgaacctgggcgtgaacccgtcgctgaccatcaccgcgcaggccgaacgg
gcgtgcgcgatgtggccccgcgccggcgagcccgacccgcgcccgcccgtcggtgagccc
taccggtgcgtcccggccgtcgcgccgctccacccggcggtcccggcccacgcacccgcg
gcactgcgtctcacggtggtccgacgccccacggcctga

DBGET integrated database retrieval system