KEGG   Cellulomonas gilvus: Celgi_0361Help
Entry
Celgi_0361        CDS       T01537                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
cga  Cellulomonas gilvus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Celgi_0361
Enzymes [BR:cga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Celgi_0361
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     Celgi_0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
402128..403663
Genome map
AA seq 511 aa AA seqDB search
MSDAIVPVTDAQGHRLDQIRLTGVTATGYHGVFEHERREGQTFSVDVVVHLDTRRAAASD
DLTRTLDYGTLATRVVAVVEGPAYDLIETLAERIAATVLADGTVHTVDVAVHKPQAPIPV
PFGDVVVAIRRDRTKLPAAEPYLPPEASAASGAAAATAARPDDAPAGHPRTSQMPVAGAA
FAAGPVVPPLVPMPLGAAAAPAGGLLDAGPAGPAPDEQPTTAFVVPELQETRVVEPVPQD
AWSAEAAAPVGAPVGDPAAGPALDRLDAVPDAPVDAVLALGANLGNAQETLRQAVGQISR
TPGVELVEVSPLARTAAVGGPEQPDFLNAVLLVRTTLSARGLLNAVQAVEQAHGRERLEH
WGPRTLDVDVILYGSVLAVTEDLELPHPRAHERAFVLQPWAQVDPDAVLPGLGGGPVAAL
AATAPDRDGVRWLALDWLTAPVPSAQPEPEHPQQQSSQELHPQAFASQELHPQAHYSREL
HPDQPAAAAHPLDPERVRDVTGFPPPTPSGP
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacgcgatcgtcccggtgaccgatgcgcagggccaccgcctggaccagatccgg
ctgaccggggtcacggcgacggggtaccacggcgtgttcgagcacgagcgccgcgagggg
cagacgttctccgtggacgtggtggtgcacctggacacgcgtcgcgcggccgcgagcgac
gacctcacgcgcacgctcgactacggcacgttggccacgcgcgtcgtcgcggtggtcgag
ggcccggcgtacgacctgatcgagacgctcgccgagcgcatcgccgcgaccgtgctcgcg
gacggcacggtgcacaccgtggacgtcgcggtgcacaagccgcaggccccgatccccgtg
ccgttcggcgacgtggtggtcgcgatccggcgcgaccggaccaagctgcccgcggctgag
ccgtacctcccgcccgaggcgtccgcggcgtccggcgccgccgcggccacggcagcgcgg
cccgacgacgcacctgccgggcacccgcgcacgtcgcagatgccggtcgccggtgccgcg
ttcgccgccggacccgtggtgccgcccctggtcccgatgcccctgggagcggccgccgca
ccggccgggggtctcctcgacgccggacctgcgggacccgcgcccgacgagcagccgacc
accgcgttcgtcgtgcccgagctgcaggagacccgcgtcgtcgagcccgtgccgcaggac
gcgtggtccgccgaggccgccgcacccgtcggggcaccggtgggtgacccggccgctgga
ccggccctcgaccggctcgacgccgtgcccgacgccccggtggacgccgtgctcgcgctc
ggcgcgaacctgggcaacgcgcaggagacgctgcgccaggccgtcggccagatctcgcgc
accccgggtgtcgagctggtggaggtctcgccgctcgcccggaccgccgcggtgggcggg
ccggagcagccggacttcctcaacgcggtgctgctggtgcgcaccacgctgtccgcgcgg
ggtcttctcaacgccgtgcaggcggtcgagcaggcgcacggccgcgaacggctcgagcac
tgggggccgcgcacgctggacgtcgacgtgatcctgtacggctcggtgctggccgtgacc
gaggacctcgagctgccgcacccgcgcgcgcacgagcgtgcgttcgtgctgcagccgtgg
gcacaggtcgaccccgacgcggtgctcccgggcctgggcggcgggcccgtcgcggcgctc
gcggccactgcaccggaccgggacggcgtgcgctggctcgcgctggactggctgaccgcg
cccgtgccctcggcccagcccgagcccgagcacccgcagcagcagagctcgcaggagctg
cacccgcaggccttcgcctcccaggagctgcacccgcaggcgcactactcccgcgagctg
cacccggatcagccggccgcggccgcgcacccgctcgaccccgagcgcgtgcgtgacgtg
accggcttcccgccccccacgccgtcggggccgtga

DBGET integrated database retrieval system