KEGG   Cellulomonas gilvus: Celgi_0378Help
Entry
Celgi_0378        CDS       T01537                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
cga  Cellulomonas gilvus
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Celgi_0378
   00051 Fructose and mannose metabolism
    Celgi_0378
Enzymes [BR:cga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Celgi_0378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(419594..420784)
Genome map
AA seq 396 aa AA seqDB search
MVRKPTPADKFSFGLWTVGWNAQDPFGSATRPWLDPVESVHKLAELGAAHVTFHDDDVVP
FGSSDAEREKILDRFKGALAETGITVEMVTTNTFSHPIFKDGAFTSNDRRVRRYALRKIL
RNVDLAASLDADTFVMWGGREGAEYDSAKDLYAAHQAYADGIDTVAAYIKEKGYKLRIAL
EPKPNEPRGDILLPTIGHALGLIAKLENGDIVGLNPETGHEQMAGLNYTTGLAQALWAEK
LFHIDLNGQRGIKYDQDLVFGHGDLFSAFATVDLLENGFPGGGPKYTGPVHFDYKPSRTE
DFDGVWESARANMATYLLLKERAIAFREDPEVKEALEAAGVLELAKPTLNEGETLADFLA
DRSAFEDFDVEGVAKHGFGFVRLNQLALEHALGARG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgcaagcccacccccgccgacaagttctccttcggtctgtggaccgtcggctgg
aacgcccaggacccgttcggctccgccacccgcccgtggctggacccggtggagtccgtc
cacaagctcgccgagctcggcgcggcccacgtgacgttccacgacgacgacgtcgtcccg
ttcggctcctcggacgccgagcgcgagaagatcctcgaccgcttcaagggtgcgctggcc
gagaccggcatcaccgtcgagatggtcaccaccaacacgttctcgcacccgatcttcaag
gacggcgcgttcacctcgaacgaccgccgcgtgcgccgctacgcgctgcgcaagatcctg
cgcaacgtcgacctggccgcgtccctggacgccgacacgttcgtcatgtggggcgggcgc
gagggcgccgagtacgactccgccaaggacctgtacgccgcgcaccaggcctacgccgac
ggcatcgacaccgtcgccgcgtacatcaaggagaagggctacaagctgcgcatcgcgctc
gagcccaagcccaacgagccccgtggcgacatcctgctcccgacgatcggccacgcgctc
ggcctcatcgccaagctcgagaacggcgacatcgtcggcctcaacccggagacgggccac
gagcagatggccggcctgaactacacgacgggcctcgcgcaggcgctgtgggccgagaag
ctgttccacatcgacctcaacggccagcgcggcatcaagtacgaccaggacctggtgttc
ggccacggcgacctgttctccgcgttcgcgaccgtggacctcctcgagaacggcttcccg
ggcggcggcccgaagtacaccggcccggtgcacttcgactacaagccctcgcgcaccgag
gacttcgacggcgtgtgggagtcggcgcgcgccaacatggccacctacctcctgctcaag
gagcgcgcgatcgcgttccgcgaggaccccgaggtcaaggaggccctcgaggccgccggc
gtgctcgagctcgccaagcccacgctgaacgagggcgagacgctcgccgacttcctcgcg
gaccgctccgcgttcgaggacttcgacgtcgagggcgtggccaagcacggcttcggcttc
gtgcggctcaaccagctcgcgctcgagcacgcgctcggcgcgcgcggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system