KEGG   Cellulomonas gilvus: Celgi_0384Help
Entry
Celgi_0384        CDS       T01537                                 

Definition
(RefSeq) phosphoglycerate mutase 1 family
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cga  Cellulomonas gilvus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celgi_0384
   01230 Biosynthesis of amino acids
    Celgi_0384
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celgi_0384
  Energy metabolism
   00680 Methane metabolism
    Celgi_0384
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celgi_0384
Enzymes [BR:cga01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Celgi_0384
Exosome [BR:cga04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Celgi_0384
  Exosomal proteins of melanoma cells
   Celgi_0384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
426199..426936
Genome map
AA seq 245 aa AA seqDB search
MTYTLVLLRHGESEWNAKNLFTGWVDVALSEKGVEEAKRGGALLTDAGILPDVVHTSLLR
RAITTANLALDAAGRHWIPVKRSWRLNERHYGALQGKDKKQTLDEFGEEQFMLWRRSYDV
PPPAIEPGTEFSQDADPRYAGEPVVLTECLKDVLEREMPYWESDIVPDLKAGKTVLVAAH
GNSIRALVKYLDGISDDTIAGLNIPTGIPLVYELDEDLKPTVPGGRYLDPSAAEAAIAAV
ANQGR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacaccctggtgctgctccgccacggcgagagcgagtggaacgcgaagaacctc
ttcaccggctgggtcgacgtggccctctcggagaagggtgtcgaggaggccaagcgcggc
ggtgcgctgctgaccgacgccggcatcctgcccgacgtggtgcacacctcgctcctgcgg
cgggcgatcaccacggcgaacctggccctggacgcggccggtcggcactggatccccgtg
aagcgctcgtggcgcctcaacgagcgccactacggcgcgctgcagggcaaggacaagaag
cagacgctcgacgagttcggcgaggagcagttcatgctctggcgtcgctcgtacgacgtc
ccgccgcccgcgatcgagcccggcaccgagttctcgcaggacgcggacccgcgctacgcg
ggtgagccggtcgtgctgaccgagtgcctcaaggacgtcctcgagcgcgagatgccgtac
tgggagtcggacatcgtcccggacctcaaggcgggcaagaccgtcctggtcgccgcgcac
ggcaactcgatccgcgcgctggtcaagtacctcgacggcatcagcgacgacacgatcgcg
gggctcaacatccccacgggcatcccgctggtctacgagctcgacgaggacctcaagccc
accgtccccggtggccgctacctcgacccgtccgcggccgaggccgccatcgccgccgtg
gcgaaccagggccgctga

DBGET integrated database retrieval system