KEGG   Cellulomonas gilvus: Celgi_0488Help
Entry
Celgi_0488        CDS       T01537                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cga  Cellulomonas gilvus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cga00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Celgi_0488
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Celgi_0488
Enzymes [BR:cga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Celgi_0488
Two-component system [BR:cga02022]
 CheA family
  CheA-CheYBV
   Celgi_0488
Bacterial motility proteins [BR:cga02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Celgi_0488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
532441..533589
Genome map
AA seq 382 aa AA seqDB search
MAAIRVLVVDDSVVVRRLVSDALAQAPGVEVVGVAANGRLAQAKVAQLRPDAVTMDIEMP
EMNGIEAVRALRAAGHRMPIIMFSTLTERGAEATLDALAAGATDYVAKPSNVGSVQESIA
KVAHELVPRLRSLVPVPGLGAGVAGAAPASATGAPVAGSGFASVPRAAVGAAAVRRPVTT
RPAPAPHAMRLMVLGSSTGGPEALSRVLSSLTAPPAVPVLVVQHMPPVFTRQLAARLDRL
GPATVVEAAGGELLRPGTVYIAPGDRHLEVRRAGTALETVLTDGPPVNFCRPAVDVLFRS
AVRAVAGDLLAVVLTGMGADGRTGCQEVVDAGGTVLVQDEPTSVVWGMPGAVATAGLAHQ
VLPVTEVASAVERALFTGGVAA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcggccatccgcgtcctcgtcgtcgacgactcggtcgtcgtacggcggctcgtgtcc
gacgcgctcgcgcaggcgccgggtgtcgaggtggtgggcgtcgccgcgaacggtcggctc
gcccaggcgaaggtcgcgcagctgcggccggacgcggtcacgatggacatcgagatgccg
gagatgaacggcatcgaggcggtccgggcgctgcgtgcggccgggcaccggatgccgatc
atcatgttctccacgctcaccgagcgcggggccgaggcgacgctcgacgcgctcgcggcg
ggcgccacggactacgtggccaagccgtcgaacgtcggcagcgtgcaggagtcgatcgcc
aaggtcgcgcacgagctcgtgccgcggctgcgctcgctggtgcccgtgcccggcctgggt
gcgggggtcgcgggtgcggccccggcgtccgccacgggcgcccccgtggcgggttcgggg
ttcgcgtccgtgccgcgtgccgcggtcggtgccgcggcggtgcgccgtccggtcacgacg
aggcccgcacccgcgccgcacgcgatgcgcctgatggtgctcgggtcctccacgggtggg
cccgaggcgctgtcccgcgtgctctcgtcgctcaccgcaccgcccgcggtgccggtgctc
gtggtccagcacatgccgcccgtcttcacgcgtcagctggccgcgcggctcgaccggctc
ggcccggccaccgtggtcgaggccgccggtggtgagctgctccggcccgggacggtctac
atcgcccccggcgaccggcacctcgaggtgcggcgtgcgggcaccgcgctcgagacggtg
ctcaccgacggcccgcccgtgaacttctgccgccccgcggtggacgtgctgttccgctcc
gcggtgcgtgcggtcgcgggcgacctgctcgcggtcgtgctcacgggcatgggcgcggac
ggccgcaccggctgccaggaggtcgtcgacgcgggcggcaccgtgctggtccaggacgag
ccgacgagcgtcgtgtgggggatgccgggcgcggtcgccaccgcggggctcgcccaccag
gtcctgcccgtgaccgaggtcgcgtccgccgtcgagcgggcgctgttcacaggaggtgtc
gcggcatga

DBGET integrated database retrieval system