KEGG   Cellulomonas gilvus: Celgi_0566Help
Entry
Celgi_0566        CDS       T01537                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cga  Cellulomonas gilvus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Celgi_0566
   00052 Galactose metabolism
    Celgi_0566
   00500 Starch and sucrose metabolism
    Celgi_0566
   00520 Amino sugar and nucleotide sugar metabolism
    Celgi_0566
Enzymes [BR:cga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Celgi_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
606839..607732
Genome map
AA seq 297 aa AA seqDB search
MTIHKAVIPAAGLGTRFLPATKSTPKEMLPVVDKPAIQYVVEEAVAAGLDDVLLITGRSK
RTLADHFDAVPELEAALEAKGDTERLAKVRESTDLAHVHFVRQGQPRGLGHAVLQAKHHV
GDEPFAVLLGDDLIDERDELLTTMLALQERVGGSVIALLEVPPEQISAYGCAAVEALPGE
DADTVRITGLVEKPPVDEAPSNLAIIGRYVLHPAVFEVLESTAPGRGGEIQLTDALATLM
DLPAEQGGGVTGVVFRGRRYDTGDRLDYLKAVVKIAVDRPDLGPDFKAWLTDYAAGL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgatccacaaggcagtcatccccgccgcaggactgggtacgcgattcctgcccgcc
acgaagtcgacgcccaaggagatgctccccgtcgtcgacaagccggccatccagtacgtc
gtcgaggaggccgtcgcggccggcctggacgacgtgctgctgatcaccggccgttccaag
cgcacgctcgccgaccacttcgacgcggtgcccgagctcgaggccgcgctggaggccaag
ggcgacaccgagcggctcgctaaggtccgcgagtccacggacctggcgcacgtgcacttc
gtgcggcagggccagccgcggggcctgggccacgcggtgctgcaggccaagcaccacgtg
ggcgacgagccgttcgcggtgctgctgggcgacgacctgatcgacgagcgcgacgagctg
ctcaccacgatgctcgcgctgcaggagcgcgtcggtggttcggtcatcgcgctgctcgag
gtcccgcccgagcagatctccgcgtacggctgcgcggccgtggaggcgctgcccggtgag
gatgcggacacggtccgtatcaccggcctggtcgagaagcccccggtcgacgaggcgccg
agcaacctggcgatcatcggccggtacgtgctgcaccccgcggtgttcgaggtgctcgag
agcacggcgcccggacgcggcggcgagatccagctgaccgacgcgctcgcgacgctcatg
gacctgccggccgagcagggcggcggcgtcacgggcgtcgtcttccgcggccgccgctac
gacacgggcgaccggctcgactacctcaaggccgtggtgaagatcgcggtggaccgtccg
gacctcggcccggacttcaaggcgtggctcacggactacgccgcagggctctga

DBGET integrated database retrieval system