KEGG   Cellulomonas gilvus: Celgi_0572Help
Entry
Celgi_0572        CDS       T01537                                 

Definition
Beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cga  Cellulomonas gilvus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Celgi_0572
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Celgi_0572
Enzymes [BR:cga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Celgi_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
616320..617813
Genome map
AA seq 497 aa AA seqDB search
MTDLGLVPRPVSIRQTDGAFTVGQATTVVVDPRPDLIATGVLAADLLGRVTGRLVEVRYS
DEDTEPRDVVRLRLAGDDDELLPGDEAYRLDVARTRVDLLARSTAGLIHAVVTLRQLMTE
AADGSWSAPCVHVDDAPRFAWRGLSVDVARHFLGLDALKVVVGLMAHYKLNVLHLHLTDD
QGWRLHVPSRPHLARTSSGTAVGGGPGGHYSPSDYADLVHYAAARGIVVVPEIDVPGHVN
AATHAYGELNPDGVPTPEYTGIEVGFSRLHADLPATAPFLQAVFTDVAAMTPGEYVHIGG
DEVLTMAHDEYATLVGLAAGAVRAAGKKVVGWQEIATVPLEPGTVVQYWDTRADPAPFVA
AARAGALLLMSPGSKAYLDMKYDEHTELGLEWAGHIDLRDAYDWEPTTLIEGVPPEAVLG
VEAAVWTETIRDLDELTSMLLPRLAAVAEVAWTPPEVRDWADFRERVAAHGPFWDRVGFR
WHATRQVDWPGSVRSRS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacctcggactcgtccctcgccccgtgtccatccggcagaccgacggcgccttc
acggtgggtcaggcgaccaccgtcgtcgtggacccgcggcccgatctcatcgcgaccggc
gtgctcgcggccgacctgctcggccgggtgaccgggcggctcgtcgaggtccggtacagc
gacgaggacaccgagccccgcgacgtggtgcggctgcgcctcgcgggcgacgacgacgag
ctgctgcccggcgacgaggcgtaccggctggacgtggcgcgcacgcgcgtggacctgctc
gcgcggtccacggcggggctgatccacgcggtcgtgacgttgcggcagctgatgacggag
gcggccgacggcagctggagcgcgccgtgcgtgcacgtcgacgacgcgccgcggttcgcg
tggcgcggcctgtccgtggacgtcgcgcggcacttcctgggcctcgacgcgctcaaggtc
gtcgtcgggctcatggcgcactacaagctcaacgtgctgcacctgcacctcacggacgac
cagggctggcgcctgcacgtgccgtcccggccgcacctggcgcgcacgtcgtccgggacc
gcggtcgggggcggccccggcgggcactactcgccgtccgactacgcggacctggtgcac
tacgcggcggcgcgcggcatcgtcgtcgttccggagatcgacgtccccgggcacgtcaac
gcggcgacccacgcgtacggcgagctcaacccggacggcgtgccgacgcccgagtacacc
ggcatcgaggtgggcttctcgcgcctgcacgcggacctgcccgcgaccgcgcccttcctg
caggccgtgttcaccgacgtggccgcgatgacgccgggcgagtacgtgcacatcggcggt
gacgaggtcctcaccatggcgcacgacgagtacgccaccctggtgggcctcgccgcggga
gccgtgcgcgccgcgggcaagaaggtggtcgggtggcaggagatcgccacggtgcccctc
gagccgggcacggtcgtgcagtactgggacacgcgtgcggacccggcgccgttcgtcgca
gcggcacgcgccggcgcgctgctgctgatgtccccgggctccaaggcgtacctggacatg
aagtacgacgagcacaccgagctgggcctggagtgggcgggccacatcgacctgcgcgac
gcctacgactgggagccgaccacgctgatcgagggcgtcccgcccgaggcggtgctgggc
gtcgaggccgcggtgtggaccgagaccatccgcgacctcgacgagctcacgtcgatgctc
ctgccgcggctcgccgctgtcgcggaggtggcctggaccccgcccgaggtgcgcgactgg
gcggacttccgcgagcgtgtggccgcgcacgggccgttctgggaccgcgtgggcttccgg
tggcacgccacgcgtcaggtggactggcccgggtcggtcagatccaggtcttga

DBGET integrated database retrieval system