KEGG   Cellulomonas gilvus: Celgi_0576Help
Entry
Celgi_0576        CDS       T01537                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cga  Cellulomonas gilvus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Celgi_0576
Enzymes [BR:cga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Celgi_0576
    3.5.1.-  
     Celgi_0576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
622520..623131
Genome map
AA seq 203 aa AA seqDB search
MGGRRALLVVDVQPTFCEGGALPVPGGNAVAERIARHAAAHRDRYDLVVTTQDWHVDPGG
HFSELPDFVDTWPPHGVAGTAEAELHPALSELGPDVSVKKGEFAAAYSGFEGVDGEGRAL
ATILREREVTDVDVVGIAESHCVRATALDALGLGLATRVLTDLTVPVTPEQGAAAREELA
AAGAALVSSADAFGDDPGPAQGR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgggtggacgccgggcgctgctggtcgtggacgtgcagccgacgttctgcgagggcggc
gcgctgcccgtaccgggcggcaacgccgtggccgaacgcatcgcgcggcacgccgcggcc
caccgggaccggtacgacctggtggtgaccacgcaggactggcacgtggaccccggcggc
cacttcagcgagctgcccgacttcgtggacacctggccgccccacggcgtcgccgggacc
gccgaggccgagctgcacccggcgctcagcgagctgggacccgacgtgagcgtcaagaag
ggcgagttcgcggcggcgtactcgggcttcgagggcgtcgacggcgagggccgtgcgctc
gcgacgatcctgcgcgagcgcgaggtgaccgacgtggacgtcgtcggcatcgccgagtcg
cactgcgtgcgcgcgaccgcgctcgacgcgctcgggctggggctcgcgacgcgggtgctg
acggacctcacggtcccggtcacccccgagcagggggccgccgcgcgcgaggagctggcc
gcggcgggcgcggcgctcgtctccagcgcggacgcgttcggcgacgacccgggtccggcg
caggggcgctga

DBGET integrated database retrieval system