KEGG   Cellvibrio gilvus: Celgi_0576Help
Entry
Celgi_0576        CDS       T01537                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cga  Cellvibrio gilvus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:cga00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
622520..623131
Genome map
AA seq 203 aa AA seqDB search
MGGRRALLVVDVQPTFCEGGALPVPGGNAVAERIARHAAAHRDRYDLVVTTQDWHVDPGG
HFSELPDFVDTWPPHGVAGTAEAELHPALSELGPDVSVKKGEFAAAYSGFEGVDGEGRAL
ATILREREVTDVDVVGIAESHCVRATALDALGLGLATRVLTDLTVPVTPEQGAAAREELA
AAGAALVSSADAFGDDPGPAQGR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgggtggacgccgggcgctgctggtcgtggacgtgcagccgacgttctgcgagggcggc
gcgctgcccgtaccgggcggcaacgccgtggccgaacgcatcgcgcggcacgccgcggcc
caccgggaccggtacgacctggtggtgaccacgcaggactggcacgtggaccccggcggc
cacttcagcgagctgcccgacttcgtggacacctggccgccccacggcgtcgccgggacc
gccgaggccgagctgcacccggcgctcagcgagctgggacccgacgtgagcgtcaagaag
ggcgagttcgcggcggcgtactcgggcttcgagggcgtcgacggcgagggccgtgcgctc
gcgacgatcctgcgcgagcgcgaggtgaccgacgtggacgtcgtcggcatcgccgagtcg
cactgcgtgcgcgcgaccgcgctcgacgcgctcgggctggggctcgcgacgcgggtgctg
acggacctcacggtcccggtcacccccgagcagggggccgccgcgcgcgaggagctggcc
gcggcgggcgcggcgctcgtctccagcgcggacgcgttcggcgacgacccgggtccggcg
caggggcgctga

DBGET integrated database retrieval system