KEGG   Cellvibrio gilvus: Celgi_0585Help
Entry
Celgi_0585        CDS       T01537                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cga  Cellvibrio gilvus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cga00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
632376..633329
Genome map
AA seq 317 aa AA seqDB search
MTLSSLDVTTTRQVRVRAPGKINLSLHVGPRQDDGYHALTTVFQAVSVFEEVVARACDER
VVTVSGPQSELVPTDSSNLAMVAVELLARATGIDEGVRLHIDKGVPVAGGMAGGSADAAA
ALLACDALWQTGLSRAELVELAAELGSDVPFVLQGHTAVGQGRGHLLTPVLGRGEFHWAF
AVQDRGLSAGVVYRALDELRAMGDGADVAEPPDLDDDVPLLQALRAGDAHALGAALHNDL
EPAALELDPDLAQPLAVAQDAGALGVVVSGSGPTVAALARSRQHALVLAAAFTAAGVADR
VLTATGPVAGARVISTD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctcagctcgctcgacgtgaccaccacacggcaggtgcgcgtgcgcgcgcccggg
aagatcaacctgtcgctgcatgtgggcccgcgccaggacgacggctaccacgcgctgacc
acggtgttccaggcggtctcggtgttcgaggaggtcgtcgcgcgggcgtgcgacgagcgc
gtcgtgacggtctcggggccgcagtccgagctggtgcccacggactcctccaacctggcg
atggtcgcggtcgagctcctggcccgcgcgacgggcatcgacgagggcgtgcggctgcac
atcgacaagggcgtgccggtcgcgggcggcatggcgggtggctcggccgacgcggccgcc
gcgctgctcgcgtgcgacgcgctgtggcagaccggcctgagccgcgccgagctggtggag
ctcgcggccgagctcggctcggacgtgccgttcgtgctccagggccacaccgcggtgggc
caggggcgtgggcacctgctcacgcccgtcctgggccgtggcgagttccactgggcgttc
gcggtgcaggaccgcggcctgtccgcgggcgtcgtgtaccgcgcgctcgacgagctgcgc
gcgatgggggacggcgccgacgtggccgagccgcccgacctcgacgacgacgtcccgctg
ctgcaggcgctgcgggcgggtgatgcgcatgcgctcggcgcggcgctgcacaacgacctc
gagcccgccgcgctcgagctcgacccggacctggcccagccgctcgcggtcgcgcaggac
gcgggcgccctgggcgtcgtcgtgtccggctccggtccgaccgtggcggccctggcccgg
agccggcagcacgccctggtcctcgcggcggcgttcaccgccgcgggcgtcgccgaccgc
gtcctgacggcaacgggcccggtggcaggcgcccgcgtcatctccaccgactga

DBGET integrated database retrieval system