KEGG   Cellulomonas gilvus: Celgi_0585Help
Entry
Celgi_0585        CDS       T01537                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cga  Cellulomonas gilvus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Celgi_0585
Enzymes [BR:cga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Celgi_0585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
632376..633329
Genome map
AA seq 317 aa AA seqDB search
MTLSSLDVTTTRQVRVRAPGKINLSLHVGPRQDDGYHALTTVFQAVSVFEEVVARACDER
VVTVSGPQSELVPTDSSNLAMVAVELLARATGIDEGVRLHIDKGVPVAGGMAGGSADAAA
ALLACDALWQTGLSRAELVELAAELGSDVPFVLQGHTAVGQGRGHLLTPVLGRGEFHWAF
AVQDRGLSAGVVYRALDELRAMGDGADVAEPPDLDDDVPLLQALRAGDAHALGAALHNDL
EPAALELDPDLAQPLAVAQDAGALGVVVSGSGPTVAALARSRQHALVLAAAFTAAGVADR
VLTATGPVAGARVISTD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctcagctcgctcgacgtgaccaccacacggcaggtgcgcgtgcgcgcgcccggg
aagatcaacctgtcgctgcatgtgggcccgcgccaggacgacggctaccacgcgctgacc
acggtgttccaggcggtctcggtgttcgaggaggtcgtcgcgcgggcgtgcgacgagcgc
gtcgtgacggtctcggggccgcagtccgagctggtgcccacggactcctccaacctggcg
atggtcgcggtcgagctcctggcccgcgcgacgggcatcgacgagggcgtgcggctgcac
atcgacaagggcgtgccggtcgcgggcggcatggcgggtggctcggccgacgcggccgcc
gcgctgctcgcgtgcgacgcgctgtggcagaccggcctgagccgcgccgagctggtggag
ctcgcggccgagctcggctcggacgtgccgttcgtgctccagggccacaccgcggtgggc
caggggcgtgggcacctgctcacgcccgtcctgggccgtggcgagttccactgggcgttc
gcggtgcaggaccgcggcctgtccgcgggcgtcgtgtaccgcgcgctcgacgagctgcgc
gcgatgggggacggcgccgacgtggccgagccgcccgacctcgacgacgacgtcccgctg
ctgcaggcgctgcgggcgggtgatgcgcatgcgctcggcgcggcgctgcacaacgacctc
gagcccgccgcgctcgagctcgacccggacctggcccagccgctcgcggtcgcgcaggac
gcgggcgccctgggcgtcgtcgtgtccggctccggtccgaccgtggcggccctggcccgg
agccggcagcacgccctggtcctcgcggcggcgttcaccgccgcgggcgtcgccgaccgc
gtcctgacggcaacgggcccggtggcaggcgcccgcgtcatctccaccgactga

DBGET integrated database retrieval system