KEGG   Cellulomonas gilvus: Celgi_0623Help
Entry
Celgi_0623        CDS       T01537                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
cga  Cellulomonas gilvus
Pathway
cga00620  Pyruvate metabolism
cga00630  Glyoxylate and dicarboxylate metabolism
cga01100  Metabolic pathways
cga01110  Biosynthesis of secondary metabolites
cga01120  Microbial metabolism in diverse environments
cga01200  Carbon metabolism
Module
cga_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Celgi_0623
   00630 Glyoxylate and dicarboxylate metabolism
    Celgi_0623
Enzymes [BR:cga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Celgi_0623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AEI11143
UniProt: F8A6T3
Position
complement(681732..683402)
Genome map
AA seq 556 aa AA seqDB search
MTVITPLASRTMLTDPYARPRLEVTPGADVPGTTEILTPAALDFLTDLHARFAGRRHDLL
LARQHRRDRWSNGADPGFLPLTAGIRADPAWRVAGPGPGLEDRRVEITGPTDRKMTVNAL
NSGAKVWLADHEDAMSPTWTNVVGGQLNLFDAIRGQVDFTTPEGKEYRVRPQTPTIVFRP
RGWHLTEKHIAFVDRAGQRGSSSASLVDAGLYLFHNARALIDSGRGPYLYLPKLEGHLEA
RLWDEVFRFTETYLDLPHGTIRATVLIETITAAFEMEEILYELRDHCAGLNAGRWDYIFS
VIKSFRNRGPRFVLPDRSRVTMTVPFMQAYTELLVATCHRRGAQAIGGMSAFIPNRRSPE
VTSRALQQVRADKQREAGQGFDGTWVAHPDLVPVAREVFDEALGDRVDQRHRLREDVHVT
EAQLLDIPSAGGAEPGAVTDAGLRGNVSVAVRYLESWLRGVGAAALDDLMEDAATAEISR
SQVWQWVHQEVVTDSGTLITAEHVRTVLADVLDSLTRSSGDRYDDAAALFEQVALAEEFP
TFLTVPAYAQHLVDRP
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcatcacgcccctggccagccgcaccatgctcaccgacccgtacgcccggccc
cgcctcgaggtcacccccggcgcggacgttcccggcaccaccgagatcctcacgcccgcg
gcgctcgacttcctcaccgacctgcacgcgcggttcgcgggccgccggcacgacctgctg
ctggcccgccagcaccgccgcgaccggtggtccaacggcgccgatcccgggttcctgccg
ctgaccgcgggcatccgcgccgaccccgcgtggcgcgtcgccggccccggcccgggcctc
gaggaccgccgggtggagatcaccggccccaccgaccgcaagatgaccgtcaacgcgctg
aactcgggcgccaaggtgtggctcgccgaccacgaggacgccatgagccccacgtggacc
aacgtcgtcggcggccagctcaacctgttcgacgcgatccgcggccaggtggacttcacc
acgcccgagggcaaggagtaccgcgtccggccccagaccccgacgatcgtgttccggccc
cgcgggtggcacctcaccgagaagcacatcgcgttcgtcgaccgtgccggccagcgcggc
tcgtcgtcggcctcgctggtcgacgccgggctgtacctgttccacaacgcccgtgcgctg
atcgactccggccgcggaccgtacctctacctgcccaagctcgagggtcacctcgaggcc
cggctctgggacgaggtcttccggttcaccgagacctacctggacctgccgcacggcacc
atccgcgcgaccgtcctcatcgagacgatcacggccgcgttcgagatggaggagatcctc
tacgagctgcgcgaccactgcgccgggctcaacgcgggccgctgggactacatcttcagc
gtcatcaagagcttccggaaccgcggcccccggttcgtcctgcccgaccgctcgcgcgtc
accatgaccgtgccgttcatgcaggcgtacaccgagctgctggtggccacgtgccaccgg
cgcggcgcccaggcgatcggcggcatgagcgccttcatccccaaccgccgctcgcccgag
gtgacgtcgcgtgccctccagcaggtgcgcgcggacaagcagcgcgaggccggccagggg
ttcgacggcacctgggtggcgcacccggacctggtgcccgtcgcgcgtgaggtgttcgac
gaggccctgggcgaccgcgtcgaccagcggcaccgcctgcgtgaggacgtccacgtcacc
gaggcccagctcctggacatcccgtccgccggcggggcggagccgggtgcggtgaccgac
gcgggcctgcgcggcaacgtctcggtggcggtccggtacctcgagtcctggctgcgcggc
gtcggcgccgcggcgctcgacgacctcatggaggacgccgccaccgccgagatctcgcgg
tcgcaggtgtggcagtgggtgcaccaggaggtcgtcacggactccggcaccctcatcacc
gccgagcacgtccgcacggtgctggccgacgtgctcgactcgctgacgcgctcgtcgggc
gaccggtacgacgacgccgccgcgctgttcgagcaggtcgcgctggccgaggagttcccg
accttcctcaccgtcccggcctacgcccagcacctcgtcgaccgcccctga

DBGET integrated database retrieval system