KEGG   Cellulomonas gilvus: Celgi_0624Help
Entry
Celgi_0624        CDS       T01537                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cga  Cellulomonas gilvus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celgi_0624
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Celgi_0624
Enzymes [BR:cga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Celgi_0624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(683499..684839)
Genome map
AA seq 446 aa AA seqDB search
MTTQTDPTTARREQPGHPRTGDQTTTAAELAASWEIDPRWAGVRRSHTAADVVALRGSVR
EEHTLARRGAERLWELLHSRTHVPALGALTGNQAVQQVKAGLEAIYLSGWQVAADANLSG
QTYPDQSLYPANSVPAVVRRINNALLRADQIDVAEHGRRTREWLAPIVADAEAGFGGPLN
AYELMHAMIAAGAAGVHWEDQLAAEKKCGHLGGKVLVPTSQHVRTLSAARLAADVAGVPT
VIVARTDALGADLLTTDADERDHEFLTGERTAEGYYRVRPGLDAVVARQRAYAPFADLLW
VETSTPDVGLAIEFAERIHDEHPGKLLAYNCSPSFNWRQHLSDEQIARFQRELAGHGYAF
QFITLAGFHALNHSMFTLARGYAQRGMSAYVELQGAEIDAEADGYTATRHQREVGTGYFD
RVATAISPDSATLALAGSTETAQFTH
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcagacggacccgaccactgctcggcgcgagcagccgggccacccccgcacc
ggcgaccagaccacgacggcggccgagctcgccgcgtcgtgggagatcgacccgcgctgg
gccggcgtccgccggtcccacaccgcggccgacgtcgtggcgctgcggggttccgtccgc
gaggagcacacgctggcccggcgcggcgccgagcggctgtgggagctgctgcacagccgc
acgcacgtgcccgcgctcggcgcgctcaccggcaaccaggccgtccagcaggtcaaggcc
ggcctcgaggccatctacctgtccggctggcaggtcgccgccgacgcgaacctgtccggg
cagacctacccggaccagtcgctctaccccgccaactcggtgcccgcggtggtccggcgc
atcaacaacgcgctgctgcgtgccgaccagatcgacgtcgccgagcacggccgccgcacg
cgcgagtggctcgcaccgatcgtcgcggacgccgaggccgggttcggcggccccctcaac
gcctacgagctcatgcacgcgatgatcgcggccggcgccgcgggcgtgcactgggaggac
cagctcgcggccgagaagaagtgcggccacctgggcggcaaggtgctggtcccgacgagc
cagcacgtgcgcacgctgtccgccgcccggctcgcggccgacgtcgccggggtgcccacc
gtgatcgtcgcgcgcaccgacgcgctcggcgcggacctgctcaccaccgacgccgacgag
cgcgaccacgagttcctcaccggcgagcgcaccgccgagggctactaccgcgtgcggccc
gggctcgacgcggtcgtcgcccggcagcgcgcgtacgcgccgttcgcggacctgctgtgg
gtcgagacgtcgacgcccgacgtggggctggcgatcgagttcgccgagcgcatccacgac
gagcaccccggcaagctcctggcctacaactgctcgccgtcgttcaactggcgccagcac
ctgtccgacgagcagatcgcgcggttccagcgcgagctcgcgggccacggctacgcgttc
cagttcatcaccctcgcgggcttccacgcgctcaaccactcgatgttcacgctcgcccgc
gggtacgcgcagcgcggcatgagcgcctacgtcgagctgcagggtgccgagatcgacgcc
gaggccgacggctacaccgccacgcgtcaccagcgcgaggtcggcaccggctacttcgac
cgcgtcgccaccgcgatctcgcccgacagcgccaccctcgcgctcgcgggctccaccgag
acggcccagttcacgcactga

DBGET integrated database retrieval system