KEGG   Cellulomonas gilvus: Celgi_0813Help
Entry
Celgi_0813        CDS       T01537                                 

Definition
Beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cga  Cellulomonas gilvus
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Celgi_0813
Enzymes [BR:cga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Celgi_0813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
899542..901302
Genome map
AA seq 586 aa AA seqDB search
MAAFEIGEQDFLLDGEPLQILSGALHYFRVHPDLWADRIRKARLMGLNTIETYVAWNAHA
PERGVFDLTGNLDLGRFLDLVAAEGLHAIVRPGPYICAEWDNGGLPAWLMATPGVGVRTA
EPQYLEAIAGYYDEILAVVAPRQVTRGGPVLMVQVENEYGAYGDDADYLRALVTMMRERG
IEVPLTTCDQANDEMLGRGGLPELHKTATFGSRSPERLETLRRHQPTGPLMCMEYWDGWF
DSWGEQHHTTDAAEAAADLDLLLSQGASANLYMFHGGTNLGFTNGANDKGTYLPITTSYD
YDAPLAEDGSPTAKYEAFRAVIARHAPVPGEHPAPRASAPVLDVALERRVALADALPLLV
EPKPFTHLPTADEIGQWSGFTLYRTDVESDDALLSVDEVRDRAVVLLDGEPVGTLSRTEG
LTTTSLPPRAGVLDVVVEDQGRVNYGPRIGEAKGLIGAARTATRPLERWEVGGLRLATLD
PDLLTMLHVAEPQDVAPVAGPAFCQGLFTSVPGADHFLRLDGWSKGLVWVNGTLLGRYWA
AGPTRTVYVPGPLVRVDNEIVVLELHGARTGTASFVAGPDLGHTER
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgttcgagatcggcgagcaggacttcctgctcgacggcgagccgctgcagatc
ctgtccggcgccctgcactacttccgggtgcacccggacctgtgggcggaccgcatccgc
aaggcgcgcctcatggggctcaacacgatcgagacgtacgtcgcgtggaacgcgcacgcg
cccgagcgcggcgtcttcgacctcaccggcaacctcgacctgggtcgcttcctcgacctg
gtcgccgccgagggcctgcacgcgatcgtgcgccccggcccctacatctgtgccgagtgg
gacaacggcgggctgcccgcctggctcatggcgacgcccggcgtgggcgtgcgcaccgcc
gagccccagtacctcgaggccatcgccggctactacgacgagatcctggccgtggtcgca
ccgcgccaggtcacgcgcggcggaccggtgctgatggtccaggtcgagaacgagtacggc
gcgtacggcgacgacgccgactacctgcgcgcgctggtcacgatgatgcgcgagcgcggc
atcgaggtgccgctcaccacgtgcgaccaggcgaacgacgagatgctcggccgcggcggg
ctgcccgagctgcacaagacggcgacgttcggctcccggagccccgagcgcctcgagacg
ctccgtcgccaccagcccaccggcccgctcatgtgcatggagtactgggacgggtggttc
gactcgtggggcgagcagcaccacacgacggacgccgcggaggccgcggccgacctggac
ctcctgctgtcgcagggcgcgtccgccaacctgtacatgttccacggcggcaccaacctg
ggcttcaccaacggcgccaacgacaagggcacctacctgccgatcaccacgtcgtacgac
tacgacgcgccgctcgcggaggacggcagccccacggccaagtacgaggcgttccgtgcg
gtgatcgcacgccacgcacccgtgcccggtgagcacccggcgccgcgtgcgagcgcaccc
gtgctggacgtcgcgctggagcgtcgcgtggcgctcgccgacgcgctgccgctgctggtc
gagcccaagccgttcacgcacctgccgacggccgacgagatcggtcagtggtcgggcttc
acgctgtaccggaccgacgtcgagtccgacgacgcgctgctgtcggtcgacgaggtgcgc
gaccgcgcggtcgtcctgctcgacggcgagcccgtgggcacgctgagccggaccgagggc
ctgaccaccacgagcctgcccccgcgtgcgggcgtgctcgacgtggtggtcgaggaccag
gggcgcgtcaactacggcccgcgcatcggcgaggccaaggggctcatcggtgccgcgcgc
acggcgacgcgtccgctcgagcggtgggaggtgggcggacttcgcctggccacgctcgac
cccgacctgctcacgatgctccacgtggccgagccgcaggacgtcgctcccgtcgcggga
cccgcattctgccagggcctgttcacctcggtcccgggtgccgaccacttcctgcggctc
gacggctggtccaaggggctcgtctgggtcaacggcacgctgctgggccggtactgggcc
gcaggccccacgcgcacggtctacgtcccggggccgctggtccgcgtggacaacgagatc
gtcgtgctcgagctgcacggcgcgcgcaccggtacggcgtcgttcgtcgcgggccccgac
ctcgggcacacggagcgctga

DBGET integrated database retrieval system