KEGG   Cellulomonas gilvus: Celgi_0923Help
Entry
Celgi_0923        CDS       T01537                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cga  Cellulomonas gilvus
Pathway
cga00020  Citrate cycle (TCA cycle)
cga00640  Propanoate metabolism
cga00660  C5-Branched dibasic acid metabolism
cga01100  Metabolic pathways
cga01110  Biosynthesis of secondary metabolites
cga01120  Microbial metabolism in diverse environments
cga01130  Biosynthesis of antibiotics
cga01200  Carbon metabolism
Module
cga_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cga_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celgi_0923
   00640 Propanoate metabolism
    Celgi_0923
   00660 C5-Branched dibasic acid metabolism
    Celgi_0923
Enzymes [BR:cga01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Celgi_0923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEI11442
UniProt: F8A023
Position
1007021..1008196
Genome map
AA seq 391 aa AA seqDB search
MDLFEYQARDIFEKHGVPVLGGIVATTPDEARAAAATLLGDQPGVVVVKAQVKTGGRGKA
GGVKLARSVEEAGEKAAEILGMDIKGHTVHRVMIAAGARIAQEFYFSLLLDRAERRYLAM
CSVEGGMDIEQLAVERPEALAKVAVDPRTGIDQAKADEIVAAAGFDAAIAGQVADVLRTL
WTVYRDEDATLVEVNPLVLTEEGRIVALDGKVSLDANADFRHDDHAALEDASAADPLEAR
AKEKDLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGERHGGVKPANFLDIGGGASAEVMA
AGLDIILTDPQVKSVFVNVFGGITACDAVANGIVAALQILGDEASKPLVVRLDGNNVLEG
RRILAEANHPLVTLADTMDGGADKAAELANA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgagtaccaggcacgggacatcttcgagaagcacggcgtaccggtgctc
ggcggcatcgtcgccaccacgccggacgaggcgcgggccgcggccgcgacgctgctgggt
gaccagccgggcgtcgtcgtcgtcaaggcgcaggtcaagacgggcggccgcggcaaggcg
ggcggcgtcaagctcgcgcgctcggtcgaggaggcgggcgagaaggccgccgagatcctc
ggcatggacatcaagggccacaccgtgcaccgcgtgatgatcgccgcgggggcccggatc
gcgcaggagttctacttctcgctgctgctggaccgtgccgagcgccgctacctggcgatg
tgctcggtcgagggcggcatggacatcgagcagctcgcggtcgagcgtcccgaggcgctc
gccaaggtcgcggtggacccgcgcacgggcatcgaccaggcgaaggcggacgagatcgtc
gccgccgcgggcttcgacgccgcgatcgccggccaggtggccgacgtgctgcgcacgctg
tggaccgtctaccgcgacgaggacgccacgctggtcgaggtcaacccgctcgtgctcacc
gaggagggccggatcgtcgcgctcgacggcaaggtcagcctcgacgcgaacgccgacttc
cggcacgacgaccacgcggccctcgaggacgcgagcgcggcggacccgctcgaggcccgg
gccaaggagaaggacctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaac
ggcgcggggctcgtcatgagcacgctcgacgtcgtcgcgtacgcgggtgagcgccacggc
ggcgtcaagcccgccaacttcctggacatcggcggcggcgcgtccgccgaggtcatggcg
gccggcctggacatcatcctgacggacccgcaggtcaagtcggtgttcgtcaacgtgttc
ggcgggatcacggcgtgcgacgccgtcgccaacggcatcgtcgcggcgctgcagatcctg
ggggacgaggcgagcaagccgctcgttgtgcgcctggacgggaacaacgtgctcgagggc
cgccggatcctcgcggaggcgaaccacccgctggtgacgctcgccgacacgatggacggc
ggggccgacaaggccgccgagctggcgaacgcctga

DBGET integrated database retrieval system