KEGG   Cellulomonas gilvus: Celgi_0997Help
Entry
Celgi_0997        CDS       T01537                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cga  Cellulomonas gilvus
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Celgi_0997
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Celgi_0997
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Celgi_0997
Enzymes [BR:cga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Celgi_0997
Exosome [BR:cga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Celgi_0997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1086423..1088135
Genome map
AA seq 570 aa AA seqDB search
MRRRILRPLAATTAALALVAGGAAGWAATGGSPAGPLTGHGDARRIDGDQTSTVRKALTG
GHARNVILLVGDGMGDSEITVARNYALGAAGRFAGIDALPLTGQYTTYALDRADGLPDYV
TDSAASGSAWATGTKTYNGAISVDVDGVPQRSILEIARANGLRTGNVSTAEVQDATPAVL
GAHVTSRSCYGPVATSATCPTNALENGGLGSISEQLIGTRADVTLGGGAKSFGERATAGR
WAGLTLLEQAERRGYQVVTDEAGLAAVRTADQRTPVLGLFGSGNLPVRWTGPLATPTGGG
EAAVRCTENPAYGSAPTLAELTTKAIDLLDDTGSRTGFFLQVEGASIDKQDHAANPCGQI
GETVDLDEAVQAALAFARQDRHTLVVVTADHAHSSQIVYPGTTTPGLTRTLTTADGKPMT
VAYGTAEVGGSQDHTGSQVRVAAYGPWAANVVGLTDQTDLFFTMRDALRLDPDAPAPGAP
VIRSIGLADGAVLRGHRTVRVVLQDEPRQTVFSLVRDDQVLASFTRTGSRPAVTLDARRY
AAGPAVLQVVVTGHDGLVTSRSVPVRISHR
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgacgcatccttcgtccgctcgccgcgaccaccgcggcactcgcactcgtggcc
ggcggtgcggccggatgggccgcgaccggcggctcgccggccgggcccctgacgggccac
ggcgacgcccgccggatcgacggcgaccagacctccacggtccgcaaggccctgaccggt
gggcacgcgcgcaacgtgatcctgctggtgggcgacgggatgggtgactcggagatcacg
gtggcccgcaactacgcgctcggggccgcggggcggttcgccgggatcgacgcgctgccg
ctcacgggtcagtacacgacgtacgcgctcgaccgtgcggacggcctgcctgactacgtg
acggactcggcggcctcggggtcggcgtgggccacgggcaccaagacctacaacggcgcg
atctcggtggacgtcgacggcgtcccgcagcgcagcatcctggagatcgcccgcgccaac
ggcctgcgcaccggcaacgtgtccaccgcggaggtgcaggacgcgacccccgcggtgctc
ggtgcgcacgtcaccagccggtcctgctacggcccggtcgcgacgagcgcgacgtgcccg
accaacgcgctcgagaacggcgggctcggctcgatcagcgagcagctcatcggcacgcgc
gcggacgtgacgctgggcggaggcgccaagagcttcggtgagcgcgcgaccgcgggccgg
tgggcggggctcacgctgctcgagcaggccgagcgccgcggctaccaggtggtgaccgac
gaggccggtctggccgcggtacgcaccgcggaccagcgcacgcccgtgctgggcctgttc
ggctcgggcaacctgcccgtgcggtggacgggcccgctcgccaccccgaccggtggtggt
gaggcggcggtccgctgcaccgagaaccccgcgtacggctcggcgccgacgctggccgag
ctcaccacgaaggcgatcgacctgctcgacgacacgggctcgcgcacgggcttcttcctg
caggtcgagggcgcgagcatcgacaagcaggaccacgccgccaacccgtgcggtcagatc
ggcgagacggtcgacctcgacgaggccgtgcaggccgcgctcgcgttcgcccgccaggac
cggcacacgctcgtcgtcgtgaccgccgaccacgcgcactcgagccagatcgtgtacccg
ggcaccacgacgcccggcctcacgcgcacgctgaccaccgccgacggcaagcccatgacg
gtcgcgtacggcaccgccgaggtgggcggctcgcaggaccacacgggcagccaggtgcgc
gtcgcggcctacggcccgtgggcggcgaacgtcgtcgggctgacggaccagaccgacctg
ttcttcaccatgcgggacgcgctgcgcctcgatcccgacgccccggccccgggtgccccg
gtgatccggtcgatcgggctggcggacggcgcggtgctccggggccaccggacggtgcgc
gtggtgctgcaggacgagccgcggcagaccgtgttctccctggtccgcgacgaccaggtg
ctcgcgagcttcacgcgcacggggtcgcggcccgcggtgacgctcgacgcgcgccggtac
gcggccgggcccgcggtgctccaggtggtcgtcacgggccacgacggactggtcacgagc
cgctcggtgccggtgcggatctcgcaccgctga

DBGET integrated database retrieval system