KEGG   Cellvibrio gilvus: Celgi_1040Help
Entry
Celgi_1040        CDS       T01537                                 

Definition
glycoside hydrolase 10
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cga  Cellvibrio gilvus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1134439..1135890)
Genome map
AA seq 483 aa AA seqDB search
MPITQSTRTSVPRRQVARRVAVVAAAAALAVATFAVPASAATLRELGTAAGKDVGFALDP
NRLSETAYKQIADSEFSLVVAENAMKWESTEPQRGQFSWGQADAVASYAATTGKKLYGHT
LVWHQQLPGWAQNLGASELESAMVSHASTVVRRYAGQVVAWDVVNEAFEENGTRRQSVFQ
QRLGNGYIETAFRAARSADPAVRLCYNDYNIEGINAKSDAVYAMVKDFKARGVPIDCVGL
QSHFIVGQVPSSLRQNMERFAALGVDVRVTELDIRMTMPSDSTKLAQQAADYRSVFSTCN
AVARCQGVTIWGITDKYSWVPDVFSGQGAALVWDNGYAPKPAYAAIQAAFGGVTPTPTPT
PTPTATATPTPDPTTPPAGTCSVTYGASTWNTGFTANVIVRNLSATPVDGWRLTFTFPSG
QSVTQAWSSTVTQQGAQVTVTNAPWNGSIAPGQSQTFGFNGAHPGTNGTPTGFALNGAAC
SVV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcacccagtccacgcgcacgagtgtgccgcgtcggcaggtggcacgccgcgtc
gcggtcgtcgcggcggccgccgcgctcgcggtcgccacgttcgccgtgcccgcgtcggcc
gccacgctgcgcgagctcggcaccgcggccggcaaggacgtcggcttcgcgctcgacccc
aaccggctgtccgagaccgcctacaagcagatcgccgactccgagttctccctggtggtc
gcggagaacgcgatgaagtgggagtcgaccgagccgcagcgcgggcagttctcgtggggc
caggccgacgcggtcgcgtcctacgccgcgaccaccggcaagaagctgtacggccacacg
ctcgtgtggcaccagcagctgcccgggtgggcgcagaacctgggcgcgagcgagctggag
tccgcgatggtctcgcacgcgagcaccgtcgtgcggcggtacgcgggccaggtcgtggcg
tgggacgtcgtcaacgaggccttcgaggagaacggcacgcgccgccagtcggtgttccag
cagaggctgggcaacggctacatcgagaccgcgttccgcgccgctcgcagcgccgacccg
gcggtcaggctctgctacaacgactacaacatcgagggcatcaacgcgaagtccgacgcc
gtgtacgccatggtcaaggacttcaaggcgcgcggcgtgccgatcgactgcgtggggctg
cagtcgcacttcatcgtcggccaggtaccgtcctcgctgcgccagaacatggagcgcttc
gcggccctgggcgtcgacgtgcgcgtcaccgagctcgacatccgcatgaccatgccgtcg
gactccaccaagctcgcgcagcaggccgccgactaccgctcggtgttcagcacgtgcaac
gcggtcgcgcggtgccagggcgtcaccatctggggcatcaccgacaagtactcctgggtc
cccgacgtgttctcgggacagggcgccgcgctcgtgtgggacaacggctacgcgcccaag
ccggcctacgcggcgatccaggccgcgttcgggggcgtcacaccgacacccacgccgacg
cccacgccgacggcgaccgccaccccgacgcccgaccccaccacgccgcccgccggtacg
tgcagcgtgacgtacggcgccagcacctggaacaccgggttcaccgcgaacgtgatcgtg
cgcaacctgtcggccacgcccgtcgacggctggcgcctgacgttcacgttcccgtccggg
cagagcgtgacgcaggcctggagctcgaccgtcacgcagcagggcgcgcaggtcaccgtg
accaacgcaccctggaacggctcgatcgcgcccgggcagagccagacgttcggcttcaac
ggcgcgcaccccggcaccaacggcacgccgaccgggttcgcgctcaacggcgcggcctgc
tcggtcgtctga

DBGET integrated database retrieval system