KEGG   Cellvibrio gilvus: Celgi_1089Help
Entry
Celgi_1089        CDS       T01537                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cga  Cellvibrio gilvus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cga00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1195659..1196471
Genome map
AA seq 270 aa AA seqDB search
MTTTDHELAAQLAVSAGRVLLALREQIADVPPAELKDRGDAAAHEHLLAELARLRPADAV
LSEEGADDPVRLSSDRVWIVDPLDGTREFSERDPDGAWRTDWAVHVALWERGAGLTAGAV
ALPGRDEVFSTGEPSRRPVSGPGPLRLAVSRSRPPTLIAQLAALADVELVPMGSAGVKAM
SVLTGQCDAYVHGGGQYEWDSAAPVAVATAAGLFCSRLDGSDLEYNRENPWLPDLVVCET
HRSADLLDLIARATGTGDAGPAPAKENAAP
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccacggaccacgagctcgcggcgcagctcgccgtgagcgcgggacgcgtgctc
ctcgcgctgcgcgagcagatcgcggacgtgcccccggccgagctcaaggaccgcggcgac
gcggctgcgcacgagcatctcctcgccgagctcgcacgcctgcggcccgccgacgccgtg
ctgtccgaggagggcgcggacgacccggtccggctctcgagcgaccgcgtctggatcgtc
gacccgctcgacgggacccgggagttctcggagcgggaccccgacggtgcgtggcggacg
gactgggccgtgcacgtggccctgtgggagcgcggcgcgggcctcacggcgggcgcggtg
gccctgcccgggcgcgacgaggtgttctcgaccggcgagccgagccgccggcccgtgtcc
gggcccgggccgctccgcctcgcggtgagccgcagccgcccgcccacgctcatcgcgcag
ctcgcggcgctcgcggacgtcgagctcgtgcccatgggctcggcgggcgtgaaggcgatg
tccgtgctcaccggccagtgcgacgcgtacgtgcacggcggcggccagtacgagtgggac
tcggcggcgcccgtggccgtcgcgaccgccgccggactgttctgctcgcggctggacggc
tccgacctggagtacaaccgcgagaacccgtggctgcccgatctcgtcgtgtgcgagacg
caccggtcggccgacctgctcgacctcatcgcccgcgccaccggtaccggtgacgcgggc
cccgcaccggcgaaggagaacgctgcgccgtga

DBGET integrated database retrieval system