KEGG   Cellulomonas gilvus: Celgi_1397Help
Entry
Celgi_1397        CDS       T01537                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cga  Cellulomonas gilvus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celgi_1397
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celgi_1397
  Amino acid metabolism
   00310 Lysine degradation
    Celgi_1397
Enzymes [BR:cga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Celgi_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1529352..1531157)
Genome map
AA seq 601 aa AA seqDB search
MSQNVQLPALGESVTEGTVTRWLKNVGDRVEVDEPLLEISTDKVDTEIPSPFAGVLEQVL
VQEDETVEVGATLAVIGSGEGAGQPDASPEQAPEQAPAEQPAAEAAPQQQSPEQHEEAAP
APAEAAPAAADSGSSAAPAGDGQEVTLPALGESVTEGTVTRWLKAEGDSVEVDEPLLEIS
TDKVDTEIPSPVAGTLQKIVVQEDETVQVGAVLALIGSGSAPAQAAPAAAPAAEAPAPAP
APAPAEQSAPAAPAQPAPVPAAPAQPAPVPAAPAPAAAPAAAPQAAPAAAGGYLTPLVRK
LAAEKGVDVASLTGTGVGGRIRKEDVLEAAAKAEAEAAAKAAAPAPAAAAPAAKAPAPAA
VSPLRGTTEKASRLRQIIAERMVEALHTQAQLTTVVEVDVTRIAKLRTAAKEDFKAREGV
NLTFLPFFVLAAIEGLKAFPKINGVLEGNTITYHGQENVGIAVDTDRGLVVPVIRDAGDL
NLGGIARKIADLAGRTRTNKIGPDELSGATFTVTNTGSGGAIIDTPIVPGGTSAILGTGA
IVKRPAVVKGPDGEDVIAIRSLCYLCLSYDHRLVDGADASRYLSALKARLEDGAFEAELG
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaacgtgcagctccccgcgctcggtgagtccgtcaccgagggcaccgtcacc
cgctggctgaagaacgtcggcgaccgcgtcgaggtcgacgagccgctgctcgagatctcg
accgacaaggtcgacaccgagatcccgtcgccgttcgccggcgtgctggagcaggtgctc
gtgcaggaggacgagacggtcgaggtcggcgcgacgctcgccgtcatcggctcaggcgag
ggtgcgggtcagcccgacgcctcgcccgagcaggcgcccgagcaggcacccgccgagcag
cccgcggccgaggccgcgccgcagcagcagtcccccgagcagcacgaggaggccgcgccg
gcgcccgccgaggccgccccggccgccgccgactccggctcgtcggccgcacccgccggt
gacgggcaggaggtcaccctccccgcgctcggcgagtcggtcaccgagggcaccgtgacg
cggtggctcaaggccgagggtgactcggtcgaggtcgacgagccgctgctcgagatctcg
accgacaaggtcgacaccgagatcccgtcgccggtcgccggcacgctgcagaagatcgtc
gtccaggaggacgagaccgtgcaggtgggcgccgtgctcgcactgatcggctcgggctcc
gccccggcgcaggccgctccggccgccgcacccgccgccgaggcgcccgcgccggccccc
gctccggctccggccgagcagtccgcaccggcggctcccgcccagcccgcgcccgtcccc
gccgctcctgcgcagcccgcgccggtcccggcggctccggcacctgctgcggcgcccgct
gccgcaccccaggccgcgcccgccgccgcgggtggctacctcacgccgctggtccgcaag
ctggcggccgagaagggtgtcgacgtcgcgtcgctcacgggcaccggtgtcggcggtcgc
atccgcaaggaggacgtcctcgaggccgcggccaaggccgaggccgaggcggccgccaag
gctgctgccccggcacctgccgcggccgcacccgcagccaaggcgcctgcccccgcggcg
gtctcgcccctgcgcggcaccaccgagaaggccagccggctgcgccagatcatcgccgag
cgcatggtcgaggcgctgcacacgcaggcccagctcacgacggtggtcgaggtcgacgtc
acgcgcatcgccaagctgcgcaccgcggccaaggaggacttcaaggcgcgggagggcgtg
aacctcacgttcctgccgttcttcgtccttgcggcgatcgagggcctcaaggcgttcccc
aagatcaacggggtgctcgagggcaacacgatcacgtaccacggccaggagaacgtgggc
atcgcggtggacaccgaccgcggcctcgtggtcccggtcatccgtgacgcgggcgacctg
aacctcggcggcatcgcccgcaagatcgccgacctcgcgggccggacccgcaccaacaag
atcgggcccgacgagctgtcgggtgcgaccttcacggtgaccaacaccggatcgggcggc
gcgatcatcgacacgccgatcgtcccgggcggcacgtccgcgatcctcggcacgggcgcg
atcgtcaagcgtcccgccgtggtcaagggcccggacggcgaggacgtcatcgccatccgc
tcgctgtgctacctgtgcctgtcctacgaccaccgtctggtcgacggcgccgacgcgtcg
cggtacctgtcggcgctcaaggcgcggctcgaggacggcgcgttcgaggccgagctcggc
ctctga

DBGET integrated database retrieval system