KEGG   Cellulomonas gilvus: Celgi_1432Help
Entry
Celgi_1432        CDS       T01537                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cga  Cellulomonas gilvus
Pathway
cga00010  Glycolysis / Gluconeogenesis
cga00052  Galactose metabolism
cga00500  Starch and sucrose metabolism
cga00520  Amino sugar and nucleotide sugar metabolism
cga00521  Streptomycin biosynthesis
cga01100  Metabolic pathways
cga01110  Biosynthesis of secondary metabolites
cga01120  Microbial metabolism in diverse environments
cga01130  Biosynthesis of antibiotics
cga01200  Carbon metabolism
Module
cga_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celgi_1432
   00052 Galactose metabolism
    Celgi_1432
   00500 Starch and sucrose metabolism
    Celgi_1432
   00520 Amino sugar and nucleotide sugar metabolism
    Celgi_1432
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Celgi_1432
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Celgi_1432
Enzymes [BR:cga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Celgi_1432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: AEI11951
UniProt: F8A3P8
Position
1563837..1564781
Genome map
AA seq 314 aa AA seqDB search
MHAIGVDIGGTKIAAGVVDDEGRILAKTRRDTEPDDAASIDAAIADVYAELSAQHKIGAI
GLAAAGFVAADRSGVLFAPNIAWRDYPLRDRVAALIDERLEIVVENDANAAGWAEFRYGA
AREVEDMLTLTIGTGLGGAIVSHGQLVRGFAGVAAEVGHMRVVPGGHYCGCGHEGCWEQY
ASGSALVRDAQAAVVAYPDRAARILELAGGEVDKIIGPHVTAAAEEGDALAIDLLAELGR
WIGEGAASVAALLDPAMVVIGGGVAAAGDLLLTPARKGFADQLSARGHRPEAEIVVAAMG
NDAGIVGAADLARI
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccatcggggtcgacatcggcgggaccaagatcgcggccggcgtggtggacgac
gaaggccggatcctggccaagacgcgtcgggacaccgagccggacgacgccgcgagcatc
gacgccgcgatcgcggacgtgtacgccgagctcagcgcgcagcacaagatcggtgcgatc
ggcctcgccgcggcggggttcgtcgccgccgaccggtcgggggtgctgttcgcgccgaac
atcgcgtggcgcgactacccgctgcgtgaccgcgtggcggcgctgatcgacgagcggctc
gagatcgtcgtggagaacgacgcgaacgccgcgggctgggccgagttccgctacggcgcg
gcgcgtgaggtcgaggacatgctcacgctcacgatcggcacggggctgggcggggcgatc
gtctcgcacggccagctggtgcgcggtttcgcgggcgtcgcggccgaggtgggtcacatg
cgcgtggtgcccggcgggcactactgcgggtgtggtcacgagggctgctgggagcagtac
gcgtcgggcagcgcgctcgtgcgggacgcccaggccgcggtcgtcgcgtacccggaccgc
gccgcgcgcatcctcgagctcgcgggcggcgaggtggacaagatcatcggtccgcacgtg
accgcggcggccgaggagggcgacgctctcgcgatcgacctgctcgccgagctcggccga
tggatcggggagggtgcggcgtcggtcgcggcgctgctcgaccccgcgatggtcgtgatc
ggcggcggtgtggctgccgcgggcgacctgctcctgacgcccgcgcgcaagggcttcgcc
gaccagctctcggcccgcggtcaccggcccgaggcggagatcgtggtcgccgcgatgggc
aacgacgccggcatcgtgggtgcggcggacctcgcgcgcatctga

DBGET integrated database retrieval system