KEGG   Cellulomonas gilvus: Celgi_1581Help
Entry
Celgi_1581        CDS       T01537                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cga  Cellulomonas gilvus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cga00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Celgi_1581
Enzymes [BR:cga01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Celgi_1581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1720596..1721222
Genome map
AA seq 208 aa AA seqDB search
MIASVRGTVAAVRLDAAVVEVGGVGMLVLATPATLAHLRVGQEATLFTSLVVREDSLTLF
GFAGDDEREVFELVQTVSGVGPRLALAMLAVHAPDDLRRAVATDDLKALERVPGIGRKGA
QRIVLELKDRIGAPTGVPATANGTPAAPGVPEDRRQQVVDALVGLGWNQKAAEDAVATVL
TDVTGPVSADEVPGLLRAALRTLGGGRG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcttcggtacgcgggacggtggccgcggtccggctggacgcggcggtggtcgag
gtgggcggcgtcgggatgctcgtcctggcgacgcccgcgacgctcgcgcacctgcgcgtc
ggccaggaggccacgttgttcacgtcgctcgtggtccgcgaggactcgctgacgctgttc
ggcttcgcgggtgacgacgaacgcgaggtgttcgagctcgtccagaccgtgagcggcgtg
ggcccgcgcctcgccctggcgatgctggccgtgcacgccccggacgacctgcgccgggcg
gtcgcgaccgacgacctcaaggcccttgagcgcgtgccgggcatcgggcgcaagggcgcc
cagcgcatcgtgctcgagctcaaggaccggatcggcgcacccacgggcgtgcccgcgacc
gcgaacggcacgcccgccgcgccgggcgtgcccgaggaccggcgccagcaggtggtcgac
gcgctggtcgggctgggctggaaccagaaggcggccgaggacgcggtcgccaccgtgctc
accgacgtcacgggtccggtgtccgccgacgaggtgccagggctgctgcgcgccgcgctg
cgcacgctgggcggcggccgtggttga

DBGET integrated database retrieval system