KEGG   Cellulomonas gilvus: Celgi_1623Help
Entry
Celgi_1623        CDS       T01537                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cga  Cellulomonas gilvus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celgi_1623
   01230 Biosynthesis of amino acids
    Celgi_1623
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celgi_1623
   00030 Pentose phosphate pathway
    Celgi_1623
   00051 Fructose and mannose metabolism
    Celgi_1623
   00052 Galactose metabolism
    Celgi_1623
  Energy metabolism
   00680 Methane metabolism
    Celgi_1623
Enzymes [BR:cga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Celgi_1623
Protein phosphatases and associated proteins [BR:cga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Celgi_1623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1767314..1768339
Genome map
AA seq 341 aa AA seqDB search
MRVGLLTGGGDVPGLNAAIRAVVKRGEGEYGHQIVGFRNGWRGVVDGDVMPLTRQHIRNV
LPVGGTLLGTARFHPHSSDGGIDSVLATLEAERLEALICIGGDGTLHAASKIAEAGVRIV
AIPKTIDNDVWGTDQSIGFDTAVTVATDAVDRIHTTAESHNRVMIVEVMGRHAGWIAATA
GIAGGAELVLAPEAPFDIEKIERFLKHRHRAHASFSIVVVAEGAVPAEGTAMHYETQVGK
FGEIVAGAIGERLKVEIEQRTGFDTRVTVLGHVQRGGTPTPTDRILGSRFGVAAIDAVTQ
GRSNVMTALRGDRVELVSLEEVAGKVKHVPDELLAVARALA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagtcggtctgctcacgggcggcggcgacgtccccggactgaatgccgccatccgt
gccgtggtcaagcggggcgagggggagtacgggcaccagatcgtcggcttccgcaacggc
tggcgcggcgtggtggacggggacgtcatgccgctgacccgccagcacatccgcaacgtc
ctgccggtcggtggcacgctgctcggcacggcgcggttccacccgcactcgagcgacggc
ggcatcgactcggtcctggccacgctggaggccgagcggctcgaggcgctgatctgcatc
ggcggcgacggcacgctgcacgccgcgagcaagatcgccgaggccggcgtccgcatcgtc
gcgatcccgaagacgatcgacaacgacgtgtgggggaccgaccagtcgatcggcttcgac
acggccgtcacggtcgccacggacgccgtcgaccgcatccacaccaccgcggagagccac
aaccgcgtgatgatcgtcgaggtcatgggacgccacgcgggctggatcgccgcgaccgcc
ggcatcgcgggcggcgcggagctcgtgctcgcgcccgaggccccgttcgacatcgagaag
atcgagcggttcctcaagcaccggcaccgcgcgcacgcgagcttctcgatcgtcgtcgtg
gccgagggtgcggtgcccgccgagggcaccgcgatgcactacgagacgcaggtcggcaag
ttcggcgagatcgtcgcgggcgcgatcggcgagcggctcaaggtggagatcgagcagcgc
accgggttcgacacgcgcgtgacggtgctgggccacgtgcagcgcggcggcacgccgacg
cccaccgaccgcatcctcggcagccgcttcggcgtcgcggcgatcgacgcggtcacgcag
ggccggtcgaacgtgatgacggcgctgcgcggcgaccgtgtcgagctcgtctcgctcgag
gaggtcgccggcaaggtcaagcacgtgcccgacgagctgctcgccgtggctcgcgcgctc
gcgtga

DBGET integrated database retrieval system