KEGG   Cellulomonas gilvus: Celgi_1623Help
Entry
Celgi_1623        CDS       T01537                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cga  Cellulomonas gilvus
Pathway
cga00010  Glycolysis / Gluconeogenesis
cga00030  Pentose phosphate pathway
cga00051  Fructose and mannose metabolism
cga00052  Galactose metabolism
cga00680  Methane metabolism
cga01100  Metabolic pathways
cga01110  Biosynthesis of secondary metabolites
cga01120  Microbial metabolism in diverse environments
cga01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celgi_1623
   00030 Pentose phosphate pathway
    Celgi_1623
   00051 Fructose and mannose metabolism
    Celgi_1623
   00052 Galactose metabolism
    Celgi_1623
  Energy metabolism
   00680 Methane metabolism
    Celgi_1623
Enzymes [BR:cga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Celgi_1623
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Celgi_1623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEI12134
UniProt: F8A531
Position
1767314..1768339
Genome map
AA seq 341 aa AA seqDB search
MRVGLLTGGGDVPGLNAAIRAVVKRGEGEYGHQIVGFRNGWRGVVDGDVMPLTRQHIRNV
LPVGGTLLGTARFHPHSSDGGIDSVLATLEAERLEALICIGGDGTLHAASKIAEAGVRIV
AIPKTIDNDVWGTDQSIGFDTAVTVATDAVDRIHTTAESHNRVMIVEVMGRHAGWIAATA
GIAGGAELVLAPEAPFDIEKIERFLKHRHRAHASFSIVVVAEGAVPAEGTAMHYETQVGK
FGEIVAGAIGERLKVEIEQRTGFDTRVTVLGHVQRGGTPTPTDRILGSRFGVAAIDAVTQ
GRSNVMTALRGDRVELVSLEEVAGKVKHVPDELLAVARALA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagtcggtctgctcacgggcggcggcgacgtccccggactgaatgccgccatccgt
gccgtggtcaagcggggcgagggggagtacgggcaccagatcgtcggcttccgcaacggc
tggcgcggcgtggtggacggggacgtcatgccgctgacccgccagcacatccgcaacgtc
ctgccggtcggtggcacgctgctcggcacggcgcggttccacccgcactcgagcgacggc
ggcatcgactcggtcctggccacgctggaggccgagcggctcgaggcgctgatctgcatc
ggcggcgacggcacgctgcacgccgcgagcaagatcgccgaggccggcgtccgcatcgtc
gcgatcccgaagacgatcgacaacgacgtgtgggggaccgaccagtcgatcggcttcgac
acggccgtcacggtcgccacggacgccgtcgaccgcatccacaccaccgcggagagccac
aaccgcgtgatgatcgtcgaggtcatgggacgccacgcgggctggatcgccgcgaccgcc
ggcatcgcgggcggcgcggagctcgtgctcgcgcccgaggccccgttcgacatcgagaag
atcgagcggttcctcaagcaccggcaccgcgcgcacgcgagcttctcgatcgtcgtcgtg
gccgagggtgcggtgcccgccgagggcaccgcgatgcactacgagacgcaggtcggcaag
ttcggcgagatcgtcgcgggcgcgatcggcgagcggctcaaggtggagatcgagcagcgc
accgggttcgacacgcgcgtgacggtgctgggccacgtgcagcgcggcggcacgccgacg
cccaccgaccgcatcctcggcagccgcttcggcgtcgcggcgatcgacgcggtcacgcag
ggccggtcgaacgtgatgacggcgctgcgcggcgaccgtgtcgagctcgtctcgctcgag
gaggtcgccggcaaggtcaagcacgtgcccgacgagctgctcgccgtggctcgcgcgctc
gcgtga

DBGET integrated database retrieval system